BLASTX nr result
ID: Papaver32_contig00007940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00007940 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN09071.1 hypothetical protein DCAR_001727 [Daucus carota subsp... 59 2e-07 XP_010252337.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 59 2e-07 XP_017228743.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 59 2e-07 XP_010252334.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 59 2e-07 KZV43714.1 hypothetical protein F511_00265 [Dorcoceras hygrometr... 55 4e-06 XP_019191103.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 55 4e-06 OAY45096.1 hypothetical protein MANES_07G030800 [Manihot esculen... 55 4e-06 XP_012066762.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 55 4e-06 XP_002303150.2 TIP120 family protein [Populus trichocarpa] EEE78... 54 7e-06 XP_016483322.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 54 1e-05 KDO42068.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] 54 1e-05 KDO42067.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] 54 1e-05 XP_019264514.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 54 1e-05 XP_016453099.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 54 1e-05 XP_009762524.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 54 1e-05 XP_009613096.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 54 1e-05 XP_006431436.1 hypothetical protein CICLE_v10000063mg [Citrus cl... 54 1e-05 KDO42065.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] 54 1e-05 >KZN09071.1 hypothetical protein DCAR_001727 [Daucus carota subsp. sativus] Length = 1175 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL M + AL LCS LMADRKS PNVGLTVRNKV Sbjct: 650 SDSDLHMAALALELCSTLMADRKSTPNVGLTVRNKV 685 >XP_010252337.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X2 [Nelumbo nucifera] Length = 1194 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADRKSIPNVGLTVR+KV Sbjct: 694 SDSDLHMTALALELCCTLMADRKSIPNVGLTVRSKV 729 >XP_017228743.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Daucus carota subsp. sativus] Length = 1219 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL M + AL LCS LMADRKS PNVGLTVRNKV Sbjct: 694 SDSDLHMAALALELCSTLMADRKSTPNVGLTVRNKV 729 >XP_010252334.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Nelumbo nucifera] XP_010252335.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Nelumbo nucifera] XP_010252336.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Nelumbo nucifera] Length = 1221 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADRKSIPNVGLTVR+KV Sbjct: 694 SDSDLHMTALALELCCTLMADRKSIPNVGLTVRSKV 729 >KZV43714.1 hypothetical protein F511_00265 [Dorcoceras hygrometricum] Length = 1201 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL M + AL LCS LMAD++S PNVGLTVRNKV Sbjct: 694 SDSDLHMAALALELCSTLMADKRSGPNVGLTVRNKV 729 >XP_019191103.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Ipomoea nil] Length = 1217 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S P+VGLTVRNKV Sbjct: 693 SDSDLHMTALALELCCTLMADRRSSPSVGLTVRNKV 728 >OAY45096.1 hypothetical protein MANES_07G030800 [Manihot esculenta] OAY45097.1 hypothetical protein MANES_07G030800 [Manihot esculenta] Length = 1218 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S PNVGL VRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADRRSSPNVGLAVRNKV 729 >XP_012066762.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Jatropha curcas] KDP42514.1 hypothetical protein JCGZ_00311 [Jatropha curcas] Length = 1218 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S PNVGL VRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADRRSSPNVGLAVRNKV 729 >XP_002303150.2 TIP120 family protein [Populus trichocarpa] EEE78129.2 TIP120 family protein [Populus trichocarpa] Length = 1215 Score = 54.3 bits (129), Expect = 7e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL M + AL LC LMADRKS PNVGL VRNKV Sbjct: 691 SDSDLHMAALALELCCTLMADRKSSPNVGLAVRNKV 726 >XP_016483322.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform X2 [Nicotiana tabacum] XP_018629723.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X2 [Nicotiana tomentosiformis] Length = 1155 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S NVGLTVRNKV Sbjct: 631 SDSDLHMTALALELCCTLMADRRSSANVGLTVRNKV 666 >KDO42068.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1167 Score = 53.9 bits (128), Expect = 1e-05 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMAD++S PNVGL VRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKV 729 >KDO42067.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1215 Score = 53.9 bits (128), Expect = 1e-05 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMAD++S PNVGL VRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKV 729 >XP_019264514.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Nicotiana attenuata] OIT36368.1 cullin-associated nedd8-dissociated protein 1 [Nicotiana attenuata] Length = 1218 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S NVGLTVRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADRRSSANVGLTVRNKV 729 >XP_016453099.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Nicotiana tabacum] Length = 1218 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S NVGLTVRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADRRSSANVGLTVRNKV 729 >XP_009762524.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Nicotiana sylvestris] XP_009762525.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Nicotiana sylvestris] Length = 1218 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S NVGLTVRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADRRSSANVGLTVRNKV 729 >XP_009613096.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Nicotiana tomentosiformis] XP_009613097.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Nicotiana tomentosiformis] XP_016483320.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform X1 [Nicotiana tabacum] XP_016483321.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform X1 [Nicotiana tabacum] Length = 1218 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMADR+S NVGLTVRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADRRSSANVGLTVRNKV 729 >XP_006431436.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] XP_006431437.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] XP_006470834.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Citrus sinensis] XP_006470835.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Citrus sinensis] ESR44676.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] ESR44677.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] KDO42066.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1218 Score = 53.9 bits (128), Expect = 1e-05 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMAD++S PNVGL VRNKV Sbjct: 694 SDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKV 729 >KDO42065.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1219 Score = 53.9 bits (128), Expect = 1e-05 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 212 SDSDLQMTSFALVLCSMLMADRKSIPNVGLTVRNKV 105 SDSDL MT+ AL LC LMAD++S PNVGL VRNKV Sbjct: 695 SDSDLHMTALALELCCTLMADKRSSPNVGLAVRNKV 730