BLASTX nr result
ID: Papaver32_contig00006573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00006573 (531 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019190483.1 PREDICTED: uncharacterized protein LOC109184855 [... 41 1e-06 >XP_019190483.1 PREDICTED: uncharacterized protein LOC109184855 [Ipomoea nil] Length = 356 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = -2 Query: 416 DDCPLFFQSNSTQMIHLQQILQHFSQASGQIINMQKSTIFFGQYV 282 DDC LF ++N+ + IH++ +L +S ASGQ IN K + F V Sbjct: 92 DDCFLFLRANTKESIHMKWVLDTYSAASGQQINFDKLILCFSANV 136 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -3 Query: 523 QEIKDVVFSIRPWDSPSNDGF*AAFNQQCWDTISAEMIVRCSFN 392 +E+++ VF + P SP DGF F Q WD + E+ + C N Sbjct: 27 EEVRNAVFHMHPDKSPGPDGFGPGFFQHFWDIVGGEVTMFCRSN 70