BLASTX nr result
ID: Papaver32_contig00006123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00006123 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW87739.1 hypothetical protein EUGRSUZ_A00108, partial [Eucalyp... 65 1e-10 XP_006292105.1 hypothetical protein CARUB_v10018301mg, partial [... 62 9e-10 XP_013462650.1 60S ribosomal protein L38A [Medicago truncatula] ... 61 1e-09 WP_071414624.1 hypothetical protein [Acinetobacter baumannii] OI... 61 1e-09 XP_003593868.1 60S ribosomal protein L38A [Medicago truncatula] ... 61 1e-09 ABK21487.1 unknown [Picea sitchensis] ABR16681.1 unknown [Picea ... 61 1e-09 XP_007159382.1 hypothetical protein PHAVU_002G233500g, partial [... 62 2e-09 JAU80427.1 60S ribosomal protein L38, partial [Noccaea caerulesc... 61 2e-09 XP_004485978.1 PREDICTED: 60S ribosomal protein L38-like [Cicer ... 61 2e-09 GAU49296.1 hypothetical protein TSUD_89210, partial [Trifolium s... 60 3e-09 JAU46126.1 60S ribosomal protein L38, partial [Noccaea caerulesc... 61 3e-09 JAU07837.1 60S ribosomal protein L38, partial [Noccaea caerulesc... 61 3e-09 XP_013456319.1 60S ribosomal protein L38A [Medicago truncatula] ... 60 3e-09 XP_019056685.1 PREDICTED: 60S ribosomal protein L38 [Tarenaya ha... 60 3e-09 XP_003606815.2 60S ribosomal protein L38A [Medicago truncatula] ... 60 3e-09 CBI17596.3 unnamed protein product, partial [Vitis vinifera] 62 3e-09 CDX71899.1 BnaC08g29750D [Brassica napus] 61 4e-09 CDY44229.1 BnaC03g24210D [Brassica napus] 60 5e-09 XP_010528118.1 PREDICTED: 60S ribosomal protein L38 [Tarenaya ha... 60 6e-09 GAU19618.1 hypothetical protein TSUD_383130, partial [Trifolium ... 59 6e-09 >KCW87739.1 hypothetical protein EUGRSUZ_A00108, partial [Eucalyptus grandis] Length = 100 Score = 64.7 bits (156), Expect = 1e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 127 WGSSLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 W SS + + MPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 23 WPSSSVCSDMPKQIHEIKDFLLTARRKDARSVKIKRSKD 61 >XP_006292105.1 hypothetical protein CARUB_v10018301mg, partial [Capsella rubella] EOA25003.1 hypothetical protein CARUB_v10018301mg, partial [Capsella rubella] Length = 100 Score = 62.4 bits (150), Expect = 9e-10 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 5/46 (10%) Frame = +1 Query: 121 VLWGSSLISAT-----MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 VLW ++AT MPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 16 VLWVKEKVAATKSHPTMPKQIHEIKDFLLTARRKDARSVKIKRSKD 61 >XP_013462650.1 60S ribosomal protein L38A [Medicago truncatula] KEH36685.1 60S ribosomal protein L38A [Medicago truncatula] Length = 64 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSVRIKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVRIKRSKD 30 >WP_071414624.1 hypothetical protein [Acinetobacter baumannii] OIC45660.1 hypothetical protein A7L55_20915 [Acinetobacter baumannii] Length = 69 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSVRIKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVRIKRSKD 30 >XP_003593868.1 60S ribosomal protein L38A [Medicago truncatula] AES64119.1 60S ribosomal protein L38A [Medicago truncatula] Length = 69 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSVRIKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVRIKRSKD 30 >ABK21487.1 unknown [Picea sitchensis] ABR16681.1 unknown [Picea sitchensis] ACN40153.1 unknown [Picea sitchensis] Length = 69 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSVRIKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVRIKRSKD 30 >XP_007159382.1 hypothetical protein PHAVU_002G233500g, partial [Phaseolus vulgaris] ESW31376.1 hypothetical protein PHAVU_002G233500g, partial [Phaseolus vulgaris] Length = 122 Score = 62.0 bits (149), Expect = 2e-09 Identities = 34/51 (66%), Positives = 43/51 (84%), Gaps = 2/51 (3%) Frame = +1 Query: 97 FSASSNFVV-LWGSSLIS-ATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 F +S+ V L+ ++ +S ATMPKQI+EIKDFLLTARRKDARSV+IKRS+D Sbjct: 33 FQLTSHLVAPLFSATAVSIATMPKQIHEIKDFLLTARRKDARSVKIKRSRD 83 >JAU80427.1 60S ribosomal protein L38, partial [Noccaea caerulescens] Length = 94 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 133 SSLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 SS TMPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 19 SSTRDPTMPKQIHEIKDFLLTARRKDARSVKIKRSKD 55 >XP_004485978.1 PREDICTED: 60S ribosomal protein L38-like [Cicer arietinum] Length = 96 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 136 SLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 SL TMPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 22 SLSFRTMPKQIHEIKDFLLTARRKDARSVKIKRSKD 57 >GAU49296.1 hypothetical protein TSUD_89210, partial [Trifolium subterraneum] Length = 61 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSV+IKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVKIKRSKD 30 >JAU46126.1 60S ribosomal protein L38, partial [Noccaea caerulescens] JAU59457.1 60S ribosomal protein L38, partial [Noccaea caerulescens] Length = 104 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 133 SSLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 SS TMPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 29 SSTRDPTMPKQIHEIKDFLLTARRKDARSVKIKRSKD 65 >JAU07837.1 60S ribosomal protein L38, partial [Noccaea caerulescens] Length = 104 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 133 SSLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 SS TMPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 29 SSTRDPTMPKQIHEIKDFLLTARRKDARSVKIKRSKD 65 >XP_013456319.1 60S ribosomal protein L38A [Medicago truncatula] KEH30350.1 60S ribosomal protein L38A [Medicago truncatula] Length = 63 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSV+IKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVKIKRSKD 30 >XP_019056685.1 PREDICTED: 60S ribosomal protein L38 [Tarenaya hassleriana] Length = 69 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSV+IKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVKIKRSKD 30 >XP_003606815.2 60S ribosomal protein L38A [Medicago truncatula] AES89012.2 60S ribosomal protein L38A [Medicago truncatula] Length = 69 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSV+IKRSKD Sbjct: 1 MPKQINEIKDFLLTARRKDARSVKIKRSKD 30 >CBI17596.3 unnamed protein product, partial [Vitis vinifera] Length = 127 Score = 61.6 bits (148), Expect = 3e-09 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 88 FISFSASSNFVVLWGSSLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 F++FS+S S ++ MPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 39 FLAFSSSETAAS--SGSFRNSKMPKQIHEIKDFLLTARRKDARSVKIKRSKD 88 >CDX71899.1 BnaC08g29750D [Brassica napus] Length = 102 Score = 60.8 bits (146), Expect = 4e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +1 Query: 115 FVVLWGSSLISATMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 FV + ++ +A MPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 21 FVKVAATTSEAARMPKQIHEIKDFLLTARRKDARSVKIKRSKD 63 >CDY44229.1 BnaC03g24210D [Brassica napus] Length = 86 Score = 60.1 bits (144), Expect = 5e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 151 TMPKQINEIKDFLLTARRKDARSVRIKRSKD 243 TMPKQI+EIKDFLLTARRKDARSV+IKRSKD Sbjct: 17 TMPKQIHEIKDFLLTARRKDARSVKIKRSKD 47 >XP_010528118.1 PREDICTED: 60S ribosomal protein L38 [Tarenaya hassleriana] Length = 93 Score = 60.1 bits (144), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKQINEIKDFLLTARRKDARSVRIKRSKD 243 MPKQINEIKDFLLTARRKDARSV+IKRSKD Sbjct: 25 MPKQINEIKDFLLTARRKDARSVKIKRSKD 54 >GAU19618.1 hypothetical protein TSUD_383130, partial [Trifolium subterraneum] Length = 68 Score = 59.3 bits (142), Expect = 6e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 157 PKQINEIKDFLLTARRKDARSVRIKRSKD 243 PKQINEIKDFLLTARRKDARSVRIKRSKD Sbjct: 1 PKQINEIKDFLLTARRKDARSVRIKRSKD 29