BLASTX nr result
ID: Papaver32_contig00006062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00006062 (1918 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_067662074.1 RNA-binding protein [Ferrimonas marina] SHI19694.... 60 1e-07 XP_009591299.1 PREDICTED: 26S protease regulatory subunit 4 homo... 64 1e-07 XP_016466822.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 65 1e-07 JAU37359.1 26S proteasome regulatory subunit 4 -like protein B, ... 60 2e-07 XP_006352708.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 65 2e-07 ONK70531.1 uncharacterized protein A4U43_C05F34680 [Asparagus of... 64 2e-07 KHN08607.1 26S protease regulatory subunit 4 like [Glycine soja] 59 3e-07 XP_007205498.1 hypothetical protein PRUPE_ppa008245mg [Prunus pe... 64 3e-07 KVI03824.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 64 3e-07 ONK78896.1 uncharacterized protein A4U43_C01F760 [Asparagus offi... 64 3e-07 XP_016577480.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 XP_019178625.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 XP_019165882.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 XP_017229754.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 XP_012828988.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 NP_001275024.1 26S proteasome subunit 4-like [Solanum tuberosum]... 64 3e-07 XP_009802140.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 XP_009601763.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 XP_004242383.1 PREDICTED: 26S proteasome regulatory subunit 4 ho... 64 3e-07 KMZ64434.1 putative 26S protease regulatory subunit [Zostera mar... 64 3e-07 >WP_067662074.1 RNA-binding protein [Ferrimonas marina] SHI19694.1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) [Ferrimonas marina] Length = 82 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Frame = -1 Query: 1297 VRGLPPSVDNGILRDLFDGFGKLIECIVCLDR-NKQSKGFGFIGYLHKGSREAAVRDMHK 1121 V L SVD L+ F+ FGK++ C V +DR + QSKGFGF+ ++G EAA+ +H Sbjct: 5 VGNLAYSVDKTALQKAFEAFGKVLRCTVVMDRESNQSKGFGFVQMANRGEGEAAIAALHG 64 Query: 1120 KAYNGSTIQVIKA 1082 ++ G T++V +A Sbjct: 65 QSLEGRTVRVNEA 77 >XP_009591299.1 PREDICTED: 26S protease regulatory subunit 4 homolog [Nicotiana tomentosiformis] Length = 291 Score = 64.3 bits (155), Expect = 1e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 9 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 42 >XP_016466822.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform X2 [Nicotiana tabacum] Length = 444 Score = 65.5 bits (158), Expect = 1e-07 Identities = 60/174 (34%), Positives = 75/174 (43%), Gaps = 4/174 (2%) Frame = -1 Query: 1159 KGSREAA----VRDMHKKAYNGSTIQVIKANETLEEHFKAIQRRTPIVMKPKERIVEIDE 992 KGS AA V + K + ++ IK +EE F A Q R +KP+E E D Sbjct: 45 KGSEAAARLPTVTPLTKCKFRLLKLERIKDYLLMEEEFVANQER----LKPQEEKTEEDR 100 Query: 991 SLRSMKKLVKKEPEVYVQMGSDRASGKQKLAADRDSKIEKKKALSLDLFRGQQVHXXXXX 812 S +V GS + G + D + I G + + Sbjct: 101 S------------KVDDLRGSPMSVGNLEELIDENHAIVSSSV-------GPEYYVGILS 141 Query: 811 XXXXXXGRPAVGRGERGHGGSLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 P S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 142 FVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >JAU37359.1 26S proteasome regulatory subunit 4 -like protein B, partial [Noccaea caerulescens] Length = 122 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 757 GGSLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 G S+VG++QDDVDP+++V KVEKAPLESYADIGGL+ Sbjct: 58 GMSIVGIMQDDVDPLLNVMKVEKAPLESYADIGGLE 93 >XP_006352708.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Solanum tuberosum] Length = 444 Score = 65.1 bits (157), Expect = 2e-07 Identities = 60/174 (34%), Positives = 74/174 (42%), Gaps = 4/174 (2%) Frame = -1 Query: 1159 KGSREAA----VRDMHKKAYNGSTIQVIKANETLEEHFKAIQRRTPIVMKPKERIVEIDE 992 KGS AA V + K ++ IK +EE F A Q R +KP+E E D Sbjct: 45 KGSEAAARIPAVTPLTKSKLRLLKLERIKDYLLMEEEFVANQER----LKPQEEKTEEDR 100 Query: 991 SLRSMKKLVKKEPEVYVQMGSDRASGKQKLAADRDSKIEKKKALSLDLFRGQQVHXXXXX 812 S +V GS + G + D + I G + + Sbjct: 101 S------------KVDDLRGSPMSVGNLEELIDENHAIVSSSV-------GPEYYVGILS 141 Query: 811 XXXXXXGRPAVGRGERGHGGSLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 P S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 142 FVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >ONK70531.1 uncharacterized protein A4U43_C05F34680 [Asparagus officinalis] Length = 367 Score = 64.3 bits (155), Expect = 2e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 85 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 118 >KHN08607.1 26S protease regulatory subunit 4 like [Glycine soja] Length = 92 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQD+VDP+V V KVEKAPLESY DIGGLD Sbjct: 8 SVVGLLQDEVDPMVFVMKVEKAPLESYVDIGGLD 41 >XP_007205498.1 hypothetical protein PRUPE_ppa008245mg [Prunus persica] Length = 340 Score = 63.9 bits (154), Expect = 3e-07 Identities = 35/88 (39%), Positives = 54/88 (61%), Gaps = 1/88 (1%) Frame = -1 Query: 1342 ILFCPHNEQKGYRCIVRGLPPSVDNGILRDLFDGFGKLIECIVCLDR-NKQSKGFGFIGY 1166 +LF +E+ YRC + GL S + L+D FD FGKL+E V +D+ + +S+GFGF+ + Sbjct: 116 LLFRKMSEELEYRCFIGGLAWSTSDRSLKDAFDKFGKLVEAKVVVDKFSGRSRGFGFVTF 175 Query: 1165 LHKGSREAAVRDMHKKAYNGSTIQVIKA 1082 K + E A+ +M+ +G TI V KA Sbjct: 176 DDKKAMEEAIEEMNGMDLDGRTITVDKA 203 >KVI03824.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 423 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 197 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 230 >ONK78896.1 uncharacterized protein A4U43_C01F760 [Asparagus officinalis] Length = 436 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 154 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 187 >XP_016577480.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Capsicum annuum] Length = 439 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 162 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >XP_019178625.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Ipomoea nil] Length = 443 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 161 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 194 >XP_019165882.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Ipomoea nil] Length = 443 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 161 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 194 >XP_017229754.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Daucus carota subsp. sativus] KZN12047.1 hypothetical protein DCAR_004703 [Daucus carota subsp. sativus] Length = 443 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 161 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 194 >XP_012828988.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Erythranthe guttata] EYU17968.1 hypothetical protein MIMGU_mgv1a006475mg [Erythranthe guttata] Length = 443 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 161 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 194 >NP_001275024.1 26S proteasome subunit 4-like [Solanum tuberosum] ABB02638.1 26S proteasome subunit 4-like [Solanum tuberosum] Length = 444 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 162 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >XP_009802140.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Nicotiana sylvestris] XP_016500720.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Nicotiana tabacum] XP_016433828.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Nicotiana tabacum] XP_019240585.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like [Nicotiana attenuata] OIT20138.1 26s proteasome regulatory subunit 4 -like a [Nicotiana attenuata] Length = 444 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 162 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >XP_009601763.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana tomentosiformis] XP_009769924.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana sylvestris] XP_016455056.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana tabacum] XP_016466823.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform X3 [Nicotiana tabacum] XP_019237518.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana attenuata] OIT22357.1 26s proteasome regulatory subunit 4 -like a [Nicotiana attenuata] Length = 444 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 162 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >XP_004242383.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Solanum lycopersicum] XP_015079419.1 PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Solanum pennellii] Length = 444 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 162 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 195 >KMZ64434.1 putative 26S protease regulatory subunit [Zostera marina] Length = 445 Score = 64.3 bits (155), Expect = 3e-07 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 751 SLVGLLQDDVDPVVSVTKVEKAPLESYADIGGLD 650 S+VGLLQDDVDP+VSV KVEKAPLESYADIGGLD Sbjct: 163 SVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD 196