BLASTX nr result
ID: Papaver32_contig00005809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00005809 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010107862.1 Zinc finger A20 and AN1 domain-containing stress-... 81 5e-17 XP_012066479.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 81 3e-16 XP_012485816.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 82 3e-16 CDP20483.1 unnamed protein product [Coffea canephora] 81 3e-16 XP_016691429.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 82 4e-16 XP_012485814.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 82 4e-16 XP_016691428.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 82 4e-16 XP_012485813.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 82 4e-16 XP_004303001.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 80 5e-16 XP_010244455.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 80 7e-16 XP_016691431.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 80 9e-16 XP_012485817.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 80 9e-16 XP_017608902.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 80 9e-16 XP_016669505.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 80 9e-16 KYP71109.1 Zinc finger A20 and AN1 domain-containing stress-asso... 79 1e-15 XP_007162885.1 hypothetical protein PHAVU_001G188800g [Phaseolus... 79 1e-15 XP_017419014.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 79 1e-15 XP_010101592.1 Zinc finger A20 and AN1 domain-containing stress-... 79 1e-15 XP_002282913.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 79 2e-15 KHN18756.1 Zinc finger A20 and AN1 domain-containing stress-asso... 78 2e-15 >XP_010107862.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] EXC17262.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] Length = 105 Score = 81.3 bits (199), Expect = 5e-17 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRDHC 496 MAEE +CQ P HRLCANNCGFFGSPAT+NLCSKCYRD C Sbjct: 1 MAEEHKCQAPEGHRLCANNCGFFGSPATMNLCSKCYRDFC 40 >XP_012066479.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Jatropha curcas] KDP42728.1 hypothetical protein JCGZ_23668 [Jatropha curcas] Length = 159 Score = 80.9 bits (198), Expect = 3e-16 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRDHC 496 MAEE RCQ P HRLCANNCGFFGSPAT+NLCSKCY D+C Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPATMNLCSKCYGDYC 40 >XP_012485816.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X3 [Gossypium raimondii] KJB36382.1 hypothetical protein B456_006G156200 [Gossypium raimondii] Length = 195 Score = 81.6 bits (200), Expect = 3e-16 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 374 KMAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 KMAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 30 KMAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 68 >CDP20483.1 unnamed protein product [Coffea canephora] Length = 168 Score = 80.9 bits (198), Expect = 3e-16 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRDHC 496 MAEEQ+ Q P HRLCANNCGFFGSP TLNLCSKCY+DHC Sbjct: 1 MAEEQKLQEPGSHRLCANNCGFFGSPTTLNLCSKCYKDHC 40 >XP_016691429.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X2 [Gossypium hirsutum] Length = 209 Score = 81.6 bits (200), Expect = 4e-16 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 374 KMAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 KMAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 44 KMAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 82 >XP_012485814.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X2 [Gossypium raimondii] KJB36380.1 hypothetical protein B456_006G156200 [Gossypium raimondii] Length = 209 Score = 81.6 bits (200), Expect = 4e-16 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 374 KMAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 KMAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 44 KMAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 82 >XP_016691428.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X1 [Gossypium hirsutum] Length = 212 Score = 81.6 bits (200), Expect = 4e-16 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 374 KMAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 KMAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 47 KMAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 85 >XP_012485813.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X1 [Gossypium raimondii] KJB36381.1 hypothetical protein B456_006G156200 [Gossypium raimondii] Length = 212 Score = 81.6 bits (200), Expect = 4e-16 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 374 KMAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 KMAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 47 KMAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 85 >XP_004303001.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Fragaria vesca subsp. vesca] Length = 171 Score = 80.5 bits (197), Expect = 5e-16 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRDHC 496 MAEE RCQ P HRLCAN+CGFFGSPAT+NLCSKCYRD C Sbjct: 1 MAEEHRCQAPEGHRLCANSCGFFGSPATMNLCSKCYRDFC 40 >XP_010244455.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Nelumbo nucifera] XP_010244459.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Nelumbo nucifera] Length = 168 Score = 80.1 bits (196), Expect = 7e-16 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQ P HRLCANNCGFFGSPATLNLCSKCYRD Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPATLNLCSKCYRD 38 >XP_016691431.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X3 [Gossypium hirsutum] Length = 165 Score = 79.7 bits (195), Expect = 9e-16 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 38 >XP_012485817.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X4 [Gossypium raimondii] Length = 165 Score = 79.7 bits (195), Expect = 9e-16 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 38 >XP_017608902.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium arboreum] Length = 167 Score = 79.7 bits (195), Expect = 9e-16 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 38 >XP_016669505.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium hirsutum] XP_016669506.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium hirsutum] XP_016669507.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium hirsutum] Length = 167 Score = 79.7 bits (195), Expect = 9e-16 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQTP HRLC NNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPATMNLCSKCYRD 38 >KYP71109.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Cajanus cajan] Length = 159 Score = 79.3 bits (194), Expect = 1e-15 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQ P HRLCANNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPATMNLCSKCYRD 38 >XP_007162885.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] XP_007162886.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] ESW34879.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] ESW34880.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] Length = 162 Score = 79.3 bits (194), Expect = 1e-15 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQ P HRLCANNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPATMNLCSKCYRD 38 >XP_017419014.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Vigna angularis] BAT85848.1 hypothetical protein VIGAN_04344200 [Vigna angularis var. angularis] Length = 163 Score = 79.3 bits (194), Expect = 1e-15 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQ P HRLCANNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPATMNLCSKCYRD 38 >XP_010101592.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] EXB88731.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] Length = 169 Score = 79.3 bits (194), Expect = 1e-15 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRDHC 496 MAEE RCQ P HRLCANNCGFFGS AT+NLCSKCYRD C Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSSATMNLCSKCYRDFC 40 >XP_002282913.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Vitis vinifera] XP_010654069.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Vitis vinifera] Length = 161 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RC+ P HRLCANNCGFFGSPATLNLCSKCYRD Sbjct: 1 MAEEHRCEAPEGHRLCANNCGFFGSPATLNLCSKCYRD 38 >KHN18756.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Glycine soja] Length = 133 Score = 78.2 bits (191), Expect = 2e-15 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 377 MAEEQRCQTPPEHRLCANNCGFFGSPATLNLCSKCYRD 490 MAEE RCQ P HRLC+NNCGFFGSPAT+NLCSKCYRD Sbjct: 1 MAEEHRCQAPEGHRLCSNNCGFFGSPATMNLCSKCYRD 38