BLASTX nr result
ID: Papaver32_contig00005785
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00005785 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012485816.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 60 3e-08 XP_016691429.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 60 3e-08 XP_012485814.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 60 3e-08 XP_016691428.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 60 3e-08 XP_012485813.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 60 3e-08 XP_016691431.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 58 9e-08 XP_012485817.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 58 9e-08 XP_017608902.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 58 9e-08 XP_016669505.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 58 9e-08 XP_010107862.1 Zinc finger A20 and AN1 domain-containing stress-... 56 1e-07 KYP71109.1 Zinc finger A20 and AN1 domain-containing stress-asso... 57 1e-07 XP_012066479.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 57 1e-07 XP_007162885.1 hypothetical protein PHAVU_001G188800g [Phaseolus... 57 1e-07 XP_017419014.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 57 1e-07 XP_010244455.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 57 1e-07 XP_008462560.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 57 1e-07 XP_004143315.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 57 1e-07 KHN18756.1 Zinc finger A20 and AN1 domain-containing stress-asso... 56 2e-07 XP_018458832.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 55 3e-07 KRH67896.1 hypothetical protein GLYMA_03G194000 [Glycine max] 56 3e-07 >XP_012485816.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X3 [Gossypium raimondii] KJB36382.1 hypothetical protein B456_006G156200 [Gossypium raimondii] Length = 195 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 320 KMAEEQRCQTPPEHRLCANNCGFFGSPAT 406 KMAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 30 KMAEEHRCQTPEGHRLCVNNCGFFGSPAT 58 >XP_016691429.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X2 [Gossypium hirsutum] Length = 209 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 320 KMAEEQRCQTPPEHRLCANNCGFFGSPAT 406 KMAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 44 KMAEEHRCQTPEGHRLCVNNCGFFGSPAT 72 >XP_012485814.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X2 [Gossypium raimondii] KJB36380.1 hypothetical protein B456_006G156200 [Gossypium raimondii] Length = 209 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 320 KMAEEQRCQTPPEHRLCANNCGFFGSPAT 406 KMAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 44 KMAEEHRCQTPEGHRLCVNNCGFFGSPAT 72 >XP_016691428.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X1 [Gossypium hirsutum] Length = 212 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 320 KMAEEQRCQTPPEHRLCANNCGFFGSPAT 406 KMAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 47 KMAEEHRCQTPEGHRLCVNNCGFFGSPAT 75 >XP_012485813.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X1 [Gossypium raimondii] KJB36381.1 hypothetical protein B456_006G156200 [Gossypium raimondii] Length = 212 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 320 KMAEEQRCQTPPEHRLCANNCGFFGSPAT 406 KMAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 47 KMAEEHRCQTPEGHRLCVNNCGFFGSPAT 75 >XP_016691431.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X3 [Gossypium hirsutum] Length = 165 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPAT 28 >XP_012485817.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like isoform X4 [Gossypium raimondii] Length = 165 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPAT 28 >XP_017608902.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium arboreum] Length = 167 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPAT 28 >XP_016669505.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium hirsutum] XP_016669506.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium hirsutum] XP_016669507.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium hirsutum] Length = 167 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQTP HRLC NNCGFFGSPAT Sbjct: 1 MAEEHRCQTPEGHRLCVNNCGFFGSPAT 28 >XP_010107862.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] EXC17262.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] Length = 105 Score = 56.2 bits (134), Expect = 1e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE +CQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHKCQAPEGHRLCANNCGFFGSPAT 28 >KYP71109.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Cajanus cajan] Length = 159 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >XP_012066479.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Jatropha curcas] KDP42728.1 hypothetical protein JCGZ_23668 [Jatropha curcas] Length = 159 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >XP_007162885.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] XP_007162886.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] ESW34879.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] ESW34880.1 hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] Length = 162 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >XP_017419014.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Vigna angularis] BAT85848.1 hypothetical protein VIGAN_04344200 [Vigna angularis var. angularis] Length = 163 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >XP_010244455.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Nelumbo nucifera] XP_010244459.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Nelumbo nucifera] Length = 168 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >XP_008462560.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Cucumis melo] Length = 173 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >XP_004143315.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6 [Cucumis sativus] KGN48256.1 hypothetical protein Csa_6G452080 [Cucumis sativus] Length = 173 Score = 57.4 bits (137), Expect = 1e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLCANNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCANNCGFFGSPAT 28 >KHN18756.1 Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Glycine soja] Length = 133 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLC+NNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCSNNCGFFGSPAT 28 >XP_018458832.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Raphanus sativus] Length = 122 Score = 55.5 bits (132), Expect = 3e-07 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +2 Query: 287 KENFNLKKTKTKMAEEQRCQTPPEHRLCANNCGFFGSPAT 406 K+ + K+ + + AEE RCQTP HRLCANNCGF GS AT Sbjct: 14 KDAIDAKRERYEGAEEHRCQTPEGHRLCANNCGFLGSSAT 53 >KRH67896.1 hypothetical protein GLYMA_03G194000 [Glycine max] Length = 160 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +2 Query: 323 MAEEQRCQTPPEHRLCANNCGFFGSPAT 406 MAEE RCQ P HRLC+NNCGFFGSPAT Sbjct: 1 MAEEHRCQAPEGHRLCSNNCGFFGSPAT 28