BLASTX nr result
ID: Papaver32_contig00005236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00005236 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010251505.1 PREDICTED: chromo domain-containing protein LHP1-... 89 8e-18 XP_010251504.1 PREDICTED: chromo domain-containing protein LHP1-... 89 8e-18 ONK58881.1 uncharacterized protein A4U43_C08F690 [Asparagus offi... 84 3e-17 XP_002273726.1 PREDICTED: chromo domain-containing protein LHP1 ... 84 5e-16 OIT23031.1 chromo domain protein lhp1, partial [Nicotiana attenu... 83 7e-16 XP_010097669.1 Chromo domain-containing protein LHP1 [Morus nota... 84 7e-16 XP_015895853.1 PREDICTED: chromo domain-containing protein LHP1 ... 84 8e-16 XP_019236549.1 PREDICTED: chromo domain protein LHP1-like [Nicot... 83 8e-16 XP_016459127.1 PREDICTED: chromo domain protein LHP1-like isofor... 83 8e-16 XP_009596810.1 PREDICTED: chromo domain protein LHP1-like isofor... 83 8e-16 XP_018625194.1 PREDICTED: chromo domain protein LHP1-like isofor... 83 8e-16 XP_016459126.1 PREDICTED: chromo domain protein LHP1-like isofor... 83 8e-16 XP_018817640.1 PREDICTED: chromo domain-containing protein LHP1 ... 83 9e-16 XP_018817637.1 PREDICTED: chromo domain protein LHP1 isoform X1 ... 83 1e-15 XP_016509434.1 PREDICTED: chromo domain protein LHP1-like [Nicot... 83 1e-15 XP_009776768.1 PREDICTED: chromo domain protein LHP1-like [Nicot... 83 1e-15 XP_015577785.1 PREDICTED: chromo domain-containing protein LHP1 ... 83 1e-15 XP_015577784.1 PREDICTED: chromo domain-containing protein LHP1 ... 83 1e-15 XP_015577783.1 PREDICTED: chromo domain-containing protein LHP1 ... 83 1e-15 XP_015577781.1 PREDICTED: chromo domain-containing protein LHP1 ... 83 1e-15 >XP_010251505.1 PREDICTED: chromo domain-containing protein LHP1-like isoform X2 [Nelumbo nucifera] Length = 433 Score = 89.0 bits (219), Expect = 8e-18 Identities = 35/57 (61%), Positives = 47/57 (82%) Frame = +3 Query: 3 IRSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 + +E+ + +G YE+EDVRRK+V KGQT YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 73 VEAERPKLADGFYEIEDVRRKRVRKGQTQYLIKWRGWPETANTWEPLENLQSCSDVI 129 >XP_010251504.1 PREDICTED: chromo domain-containing protein LHP1-like isoform X1 [Nelumbo nucifera] Length = 438 Score = 89.0 bits (219), Expect = 8e-18 Identities = 35/57 (61%), Positives = 47/57 (82%) Frame = +3 Query: 3 IRSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 + +E+ + +G YE+EDVRRK+V KGQT YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 73 VEAERPKLADGFYEIEDVRRKRVRKGQTQYLIKWRGWPETANTWEPLENLQSCSDVI 129 >ONK58881.1 uncharacterized protein A4U43_C08F690 [Asparagus officinalis] Length = 204 Score = 84.3 bits (207), Expect = 3e-17 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = +3 Query: 6 RSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 R E ++EG YE+E +RR++V KGQ YLIKW GWPES NTWEPI+NLQ+C D++ Sbjct: 50 REEPPKLEEGFYEIEAIRRRRVRKGQLQYLIKWRGWPESANTWEPIDNLQSCSDVI 105 >XP_002273726.1 PREDICTED: chromo domain-containing protein LHP1 [Vitis vinifera] CBI40015.3 unnamed protein product, partial [Vitis vinifera] Length = 424 Score = 84.0 bits (206), Expect = 5e-16 Identities = 33/56 (58%), Positives = 45/56 (80%) Frame = +3 Query: 6 RSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +SE+ + +G YE+E +RR++V KGQ YLIKW GWPE+ NTWEP+ENLQAC D++ Sbjct: 85 QSERPKLDDGFYEIEAIRRRRVRKGQLQYLIKWRGWPENANTWEPLENLQACSDVI 140 >OIT23031.1 chromo domain protein lhp1, partial [Nicotiana attenuata] Length = 364 Score = 83.2 bits (204), Expect = 7e-16 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 61 AEKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_010097669.1 Chromo domain-containing protein LHP1 [Morus notabilis] EXB70624.1 Chromo domain-containing protein LHP1 [Morus notabilis] Length = 451 Score = 83.6 bits (205), Expect = 7e-16 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +E+ + EG YE+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQAC D + Sbjct: 100 AERPKLDEGFYEIEAIRRKRVRKGQLQYLIKWRGWPETANTWEPLENLQACSDFI 154 >XP_015895853.1 PREDICTED: chromo domain-containing protein LHP1 [Ziziphus jujuba] Length = 481 Score = 83.6 bits (205), Expect = 8e-16 Identities = 33/55 (60%), Positives = 44/55 (80%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +E+ + EG YE+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 126 TERPKLDEGFYEIEAIRRKRVRKGQLQYLIKWRGWPETANTWEPLENLQSCSDVI 180 >XP_019236549.1 PREDICTED: chromo domain protein LHP1-like [Nicotiana attenuata] Length = 398 Score = 83.2 bits (204), Expect = 8e-16 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 61 AEKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_016459127.1 PREDICTED: chromo domain protein LHP1-like isoform X2 [Nicotiana tabacum] Length = 399 Score = 83.2 bits (204), Expect = 8e-16 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 61 AEKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_009596810.1 PREDICTED: chromo domain protein LHP1-like isoform X2 [Nicotiana tomentosiformis] Length = 399 Score = 83.2 bits (204), Expect = 8e-16 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 61 AEKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_018625194.1 PREDICTED: chromo domain protein LHP1-like isoform X1 [Nicotiana tomentosiformis] Length = 409 Score = 83.2 bits (204), Expect = 8e-16 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 61 AEKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_016459126.1 PREDICTED: chromo domain protein LHP1-like isoform X1 [Nicotiana tabacum] Length = 409 Score = 83.2 bits (204), Expect = 8e-16 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 61 AEKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_018817640.1 PREDICTED: chromo domain-containing protein LHP1 isoform X3 [Juglans regia] XP_018817641.1 PREDICTED: chromo domain-containing protein LHP1 isoform X3 [Juglans regia] Length = 421 Score = 83.2 bits (204), Expect = 9e-16 Identities = 32/55 (58%), Positives = 44/55 (80%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +E+ + +G YE+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 64 AERPKLDDGFYEIESIRRKRVRKGQPQYLIKWRGWPEAANTWEPLENLQSCSDVI 118 >XP_018817637.1 PREDICTED: chromo domain protein LHP1 isoform X1 [Juglans regia] Length = 452 Score = 83.2 bits (204), Expect = 1e-15 Identities = 32/55 (58%), Positives = 44/55 (80%) Frame = +3 Query: 9 SEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 +E+ + +G YE+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 95 AERPKLDDGFYEIESIRRKRVRKGQPQYLIKWRGWPEAANTWEPLENLQSCSDVI 149 >XP_016509434.1 PREDICTED: chromo domain protein LHP1-like [Nicotiana tabacum] Length = 401 Score = 82.8 bits (203), Expect = 1e-15 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +3 Query: 12 EKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 62 EKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_009776768.1 PREDICTED: chromo domain protein LHP1-like [Nicotiana sylvestris] Length = 401 Score = 82.8 bits (203), Expect = 1e-15 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +3 Query: 12 EKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 EK + EG YE+EDV RK+V KG+ YLIKW GWPES NTWEP+ENL C D++ Sbjct: 62 EKPKLAEGFYEIEDVWRKRVRKGKVQYLIKWRGWPESANTWEPVENLMTCYDVI 115 >XP_015577785.1 PREDICTED: chromo domain-containing protein LHP1 isoform X6 [Ricinus communis] Length = 422 Score = 82.8 bits (203), Expect = 1e-15 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +3 Query: 3 IRSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 + E+ + EG +E+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 107 VEEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPEAANTWEPLENLQSCSDVI 163 >XP_015577784.1 PREDICTED: chromo domain-containing protein LHP1 isoform X5 [Ricinus communis] Length = 434 Score = 82.8 bits (203), Expect = 1e-15 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +3 Query: 3 IRSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 + E+ + EG +E+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 107 VEEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPEAANTWEPLENLQSCSDVI 163 >XP_015577783.1 PREDICTED: chromo domain-containing protein LHP1 isoform X4 [Ricinus communis] Length = 439 Score = 82.8 bits (203), Expect = 1e-15 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +3 Query: 3 IRSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 + E+ + EG +E+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 107 VEEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPEAANTWEPLENLQSCSDVI 163 >XP_015577781.1 PREDICTED: chromo domain-containing protein LHP1 isoform X2 [Ricinus communis] Length = 460 Score = 82.8 bits (203), Expect = 1e-15 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +3 Query: 3 IRSEKEAVQEGLYEVEDVRRKKVSKGQTLYLIKWLGWPESHNTWEPIENLQACLDIV 173 + E+ + EG +E+E +RRK+V KGQ YLIKW GWPE+ NTWEP+ENLQ+C D++ Sbjct: 107 VEEERPKLDEGFFEIEAIRRKRVRKGQLQYLIKWRGWPEAANTWEPLENLQSCSDVI 163