BLASTX nr result
ID: Papaver32_contig00002323
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00002323 (442 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019223646.1 PREDICTED: F-box protein At4g22280-like [Nicotian... 57 7e-07 OMO51963.1 hypothetical protein COLO4_37447 [Corchorus olitorius] 53 1e-05 >XP_019223646.1 PREDICTED: F-box protein At4g22280-like [Nicotiana attenuata] OIT33917.1 f-boxlrr-repeat protein [Nicotiana attenuata] Length = 472 Score = 57.4 bits (137), Expect = 7e-07 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = +3 Query: 105 DDDWILSVVTPGSFLVRLKSVCFKEFIANPKEMKWVKLILKNAKALETMTI--SSFHFSD 278 +DDW L V P FL LK+V + F N E+ +++ ++KNA LE + I S HF D Sbjct: 388 EDDWNLGSV-PSCFLSSLKTVTYSNFHGNDTEISFLRNLVKNALVLEKLNIVCSKRHFGD 446 Query: 279 LLNGKSKELMVEITNLPRASTSCIFKF 359 K KE+ V++ +L R S SC KF Sbjct: 447 --PKKQKEVKVQLQSLHRGSVSCAIKF 471 >OMO51963.1 hypothetical protein COLO4_37447 [Corchorus olitorius] Length = 197 Score = 53.1 bits (126), Expect = 1e-05 Identities = 33/85 (38%), Positives = 46/85 (54%) Frame = +3 Query: 93 HDNKDDDWILSVVTPGSFLVRLKSVCFKEFIANPKEMKWVKLILKNAKALETMTISSFHF 272 HD + DDW L V P F+ LK++ F+ + EM VK++L+ A ALE M F F Sbjct: 113 HDEEQDDWKLEPVPP-CFISHLKTIDMWTFLGSEDEMHVVKVLLRTATALEKM---RFSF 168 Query: 273 SDLLNGKSKELMVEITNLPRASTSC 347 L+ + EL +I PRAS +C Sbjct: 169 FSLIKNQG-ELYEQIKKFPRASLNC 192