BLASTX nr result
ID: Papaver32_contig00001441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00001441 (685 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI03439.1 Transmembrane receptor, eukaryota [Cynara cardunculus... 77 8e-15 KJB79959.1 hypothetical protein B456_013G074700, partial [Gossyp... 77 2e-14 XP_015061644.1 PREDICTED: transmembrane protein 87A-like [Solanu... 80 8e-14 XP_012831211.1 PREDICTED: transmembrane protein 87A-like [Erythr... 80 1e-13 XP_012856789.1 PREDICTED: transmembrane protein 87A [Erythranthe... 79 2e-13 GAV80703.1 Lung_7-TM_R domain-containing protein [Cephalotus fol... 79 2e-13 XP_018839216.1 PREDICTED: transmembrane protein 87A-like [Juglan... 75 2e-13 XP_004303710.1 PREDICTED: transmembrane protein 87A [Fragaria ve... 79 2e-13 XP_010273861.1 PREDICTED: transmembrane protein 87A-like [Nelumb... 79 2e-13 CAN62240.1 hypothetical protein VITISV_033728 [Vitis vinifera] 79 2e-13 XP_002271404.1 PREDICTED: transmembrane protein 87A [Vitis vinif... 79 2e-13 XP_008784333.1 PREDICTED: transmembrane protein 87B-like [Phoeni... 79 2e-13 XP_019430411.1 PREDICTED: transmembrane protein 87A-like [Lupinu... 79 3e-13 XP_019230088.1 PREDICTED: transmembrane protein 87A [Nicotiana a... 78 4e-13 XP_016506883.1 PREDICTED: transmembrane protein 87A-like [Nicoti... 78 4e-13 XP_009788386.1 PREDICTED: transmembrane protein 87A-like [Nicoti... 78 4e-13 XP_009622142.1 PREDICTED: transmembrane protein 87A [Nicotiana t... 78 4e-13 XP_010261782.1 PREDICTED: transmembrane protein 87A-like [Nelumb... 78 4e-13 XP_006361333.1 PREDICTED: transmembrane protein 87A-like [Solanu... 78 4e-13 XP_004252401.1 PREDICTED: transmembrane protein 87A-like [Solanu... 78 4e-13 >KVI03439.1 Transmembrane receptor, eukaryota [Cynara cardunculus var. scolymus] Length = 82 Score = 76.6 bits (187), Expect = 8e-15 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 426 RKITVYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNSTW 554 + I +Y+ W+ AWIIPAFW+VLSFS+LCVICALWAPSQNS W Sbjct: 40 KSIGIYNVPWKNAWIIPAFWKVLSFSLLCVICALWAPSQNSMW 82 >KJB79959.1 hypothetical protein B456_013G074700, partial [Gossypium raimondii] Length = 129 Score = 77.0 bits (188), Expect = 2e-14 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY+++WQ AWIIPAFWQ+LSFS+LCVIC LWAPSQNST Sbjct: 33 VYNEQWQNAWIIPAFWQILSFSLLCVICVLWAPSQNST 70 >XP_015061644.1 PREDICTED: transmembrane protein 87A-like [Solanum pennellii] Length = 512 Score = 80.1 bits (196), Expect = 8e-14 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 418 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSQNST 455 >XP_012831211.1 PREDICTED: transmembrane protein 87A-like [Erythranthe guttata] EYU45894.1 hypothetical protein MIMGU_mgv1a004785mg [Erythranthe guttata] Length = 510 Score = 79.7 bits (195), Expect = 1e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY++ WQ AWIIPAFWQVLSFSVLCVICALWAPSQNST Sbjct: 416 VYNEHWQNAWIIPAFWQVLSFSVLCVICALWAPSQNST 453 >XP_012856789.1 PREDICTED: transmembrane protein 87A [Erythranthe guttata] EYU21300.1 hypothetical protein MIMGU_mgv1a020482mg [Erythranthe guttata] Length = 508 Score = 79.3 bits (194), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY+++WQ AWIIPAFWQVLSFSVLC+ICALWAPSQNST Sbjct: 415 VYNEQWQKAWIIPAFWQVLSFSVLCIICALWAPSQNST 452 >GAV80703.1 Lung_7-TM_R domain-containing protein [Cephalotus follicularis] Length = 512 Score = 79.3 bits (194), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY++RWQ+AWIIPAFWQVLSFS+LCVIC LWAPSQNST Sbjct: 417 VYNERWQSAWIIPAFWQVLSFSLLCVICVLWAPSQNST 454 >XP_018839216.1 PREDICTED: transmembrane protein 87A-like [Juglans regia] Length = 153 Score = 75.1 bits (183), Expect = 2e-13 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY+++WQTAWIIPAFWQVLSF + CVICALWAPS+NST Sbjct: 110 VYNEKWQTAWIIPAFWQVLSFFLRCVICALWAPSRNST 147 >XP_004303710.1 PREDICTED: transmembrane protein 87A [Fragaria vesca subsp. vesca] Length = 502 Score = 79.0 bits (193), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 407 VYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 444 >XP_010273861.1 PREDICTED: transmembrane protein 87A-like [Nelumbo nucifera] Length = 508 Score = 79.0 bits (193), Expect = 2e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY++RWQ+AWIIPAFWQ+LSFS+LCVIC LWAPSQNST Sbjct: 414 VYNERWQSAWIIPAFWQILSFSLLCVICVLWAPSQNST 451 >CAN62240.1 hypothetical protein VITISV_033728 [Vitis vinifera] Length = 510 Score = 79.0 bits (193), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 416 VYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 453 >XP_002271404.1 PREDICTED: transmembrane protein 87A [Vitis vinifera] CBI35846.3 unnamed protein product, partial [Vitis vinifera] Length = 510 Score = 79.0 bits (193), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 416 VYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 453 >XP_008784333.1 PREDICTED: transmembrane protein 87B-like [Phoenix dactylifera] Length = 527 Score = 79.0 bits (193), Expect = 2e-13 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ+AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 428 VYNERWQSAWIIPAFWQVLSFSLLCVICALWAPSQNS 464 >XP_019430411.1 PREDICTED: transmembrane protein 87A-like [Lupinus angustifolius] OIW20115.1 hypothetical protein TanjilG_01888 [Lupinus angustifolius] Length = 508 Score = 78.6 bits (192), Expect = 3e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 +Y+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 413 IYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 450 >XP_019230088.1 PREDICTED: transmembrane protein 87A [Nicotiana attenuata] OIT29675.1 hypothetical protein A4A49_23375 [Nicotiana attenuata] Length = 507 Score = 78.2 bits (191), Expect = 4e-13 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ AWIIPAFWQVLSFS+LC+ICALWAPSQNS Sbjct: 415 VYNERWQNAWIIPAFWQVLSFSLLCIICALWAPSQNS 451 >XP_016506883.1 PREDICTED: transmembrane protein 87A-like [Nicotiana tabacum] Length = 507 Score = 78.2 bits (191), Expect = 4e-13 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ AWIIPAFWQVLSFS+LC+ICALWAPSQNS Sbjct: 415 VYNERWQNAWIIPAFWQVLSFSLLCIICALWAPSQNS 451 >XP_009788386.1 PREDICTED: transmembrane protein 87A-like [Nicotiana sylvestris] XP_016444363.1 PREDICTED: transmembrane protein 87A-like [Nicotiana tabacum] Length = 507 Score = 78.2 bits (191), Expect = 4e-13 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ AWIIPAFWQVLSFS+LC+ICALWAPSQNS Sbjct: 415 VYNERWQNAWIIPAFWQVLSFSLLCIICALWAPSQNS 451 >XP_009622142.1 PREDICTED: transmembrane protein 87A [Nicotiana tomentosiformis] Length = 507 Score = 78.2 bits (191), Expect = 4e-13 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ AWIIPAFWQVLSFS+LC+ICALWAPSQNS Sbjct: 415 VYNERWQNAWIIPAFWQVLSFSLLCIICALWAPSQNS 451 >XP_010261782.1 PREDICTED: transmembrane protein 87A-like [Nelumbo nucifera] Length = 509 Score = 78.2 bits (191), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 551 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPS NST Sbjct: 415 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSHNST 452 >XP_006361333.1 PREDICTED: transmembrane protein 87A-like [Solanum tuberosum] Length = 512 Score = 78.2 bits (191), Expect = 4e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 418 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSQNS 454 >XP_004252401.1 PREDICTED: transmembrane protein 87A-like [Solanum lycopersicum] Length = 512 Score = 78.2 bits (191), Expect = 4e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 438 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 548 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 418 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSQNS 454