BLASTX nr result
ID: Papaver32_contig00000727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00000727 (460 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAM82872.1 hypothetical protein ANO11243_008580 [fungal sp. No.1... 83 3e-17 XP_008719921.1 hypothetical protein HMPREF1541_07375 [Cyphelloph... 76 8e-15 KFY22263.1 hypothetical protein V493_06717 [Pseudogymnoascus sp.... 74 1e-13 KEQ85369.1 hypothetical protein M438DRAFT_344706 [Aureobasidium ... 74 1e-13 XP_013339941.1 hypothetical protein AUEXF2481DRAFT_44055 [Aureob... 72 1e-13 XP_001239129.1 60S ribosomal protein L14-A [Coccidioides immitis... 73 1e-13 OBT85807.1 hypothetical protein VE02_06030 [Pseudogymnoascus sp.... 73 1e-13 OBT79858.1 hypothetical protein VF21_01610 [Pseudogymnoascus sp.... 73 1e-13 OBT54468.1 hypothetical protein VE04_03795 [Pseudogymnoascus sp.... 73 1e-13 KFZ05058.1 hypothetical protein V501_08698 [Pseudogymnoascus sp.... 73 1e-13 KFY34027.1 hypothetical protein V494_07122 [Pseudogymnoascus sp.... 73 1e-13 KFY10254.1 hypothetical protein V492_05108 [Pseudogymnoascus sp.... 73 1e-13 KFX99879.1 hypothetical protein O988_03610 [Pseudogymnoascus sp.... 73 1e-13 XP_012745278.1 hypothetical protein GMDG_06836 [Pseudogymnoascus... 73 1e-13 KEQ65781.1 hypothetical protein M437DRAFT_18786, partial [Aureob... 73 2e-13 EME49592.1 hypothetical protein DOTSEDRAFT_68390 [Dothistroma se... 72 2e-13 KZM18827.1 structural constituent of ribosome [Ascochyta rabiei] 72 3e-13 XP_018003229.1 60S ribosomal protein L14-B [Phialophora attae] K... 72 3e-13 OCK86824.1 60S ribosomal protein L14 [Cenococcum geophilum 1.58] 72 3e-13 XP_016219231.1 hypothetical protein PV09_00260 [Verruconis gallo... 72 4e-13 >GAM82872.1 hypothetical protein ANO11243_008580 [fungal sp. No.11243] Length = 148 Score = 82.8 bits (203), Expect = 3e-17 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E E+E K+NNS +AK RAQ +RR L DFERFKVMRLRKQARF+VRKTLAAA+A+ Sbjct: 90 EKAEVEKKWNNSTWAKSRAQSARRRQLTDFERFKVMRLRKQARFEVRKTLAAARAS 145 >XP_008719921.1 hypothetical protein HMPREF1541_07375 [Cyphellophora europaea CBS 101466] ETN37752.1 hypothetical protein HMPREF1541_07375 [Cyphellophora europaea CBS 101466] Length = 145 Score = 76.3 bits (186), Expect = 8e-15 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E QEI+ K S +AKKR QQ +R+NL+DFERFKVMRL+KQARF+++KT A KAA Sbjct: 89 EKQEIDQKIEESTFAKKRDQQQRRQNLSDFERFKVMRLKKQARFEIKKTAAKVKAA 144 >KFY22263.1 hypothetical protein V493_06717 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] Length = 147 Score = 73.6 bits (179), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESTWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >KEQ85369.1 hypothetical protein M438DRAFT_344706 [Aureobasidium pullulans EXF-150] Length = 149 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKA 296 E ++SK+NNS +AK R + KR+ L DFERFKVMRLRKQARF+VRK AAA+A Sbjct: 90 EKDSVDSKWNNSAWAKNRERSVKRKQLTDFERFKVMRLRKQARFEVRKQFAAARA 144 >XP_013339941.1 hypothetical protein AUEXF2481DRAFT_44055 [Aureobasidium subglaciale EXF-2481] KEQ91467.1 hypothetical protein AUEXF2481DRAFT_44055 [Aureobasidium subglaciale EXF-2481] Length = 110 Score = 72.4 bits (176), Expect = 1e-13 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKA 296 E ++SK+NNS +AK R + KR+ L DFERFKVMRLRKQARF+VRK AA++A Sbjct: 51 EKNSVDSKWNNSAWAKNRERSVKRKQLTDFERFKVMRLRKQARFEVRKQFAASRA 105 >XP_001239129.1 60S ribosomal protein L14-A [Coccidioides immitis RS] XP_003072088.1 60S ribosomal protein L14 [Coccidioides posadasii C735 delta SOWgp] EER29943.1 60S ribosomal protein L14-A, putative [Coccidioides posadasii C735 delta SOWgp] EFW19021.1 ribosomal protein L14 [Coccidioides posadasii str. Silveira] EAS27546.3 60S ribosomal protein L14-A [Coccidioides immitis RS] KMM71368.1 60S ribosomal protein L14 [Coccidioides posadasii RMSCC 3488] KMP09504.1 60S ribosomal protein L14-A [Coccidioides immitis RMSCC 2394] KMU91897.1 60S ribosomal protein L14-A [Coccidioides immitis H538.4] Length = 146 Score = 73.2 bits (178), Expect = 1e-13 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E EI++K+ S+YAKKR QQ +RRNL DFERFKVMRL+KQAR++V+K A +AA Sbjct: 90 EKAEIDAKWAQSNYAKKREQQERRRNLTDFERFKVMRLKKQARYEVQKAQAKVRAA 145 >OBT85807.1 hypothetical protein VE02_06030 [Pseudogymnoascus sp. 03VT05] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >OBT79858.1 hypothetical protein VF21_01610 [Pseudogymnoascus sp. 05NY08] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >OBT54468.1 hypothetical protein VE04_03795 [Pseudogymnoascus sp. 24MN13] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >KFZ05058.1 hypothetical protein V501_08698 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >KFY34027.1 hypothetical protein V494_07122 [Pseudogymnoascus sp. VKM F-4513 (FW-928)] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >KFY10254.1 hypothetical protein V492_05108 [Pseudogymnoascus sp. VKM F-4246] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >KFX99879.1 hypothetical protein O988_03610 [Pseudogymnoascus sp. VKM F-3808] KFY43278.1 hypothetical protein V495_04051 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY54442.1 hypothetical protein V497_07699 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] KFY86734.1 hypothetical protein V500_07437 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ14174.1 hypothetical protein V502_06199 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >XP_012745278.1 hypothetical protein GMDG_06836 [Pseudogymnoascus destructans 20631-21] XP_018127683.1 hypothetical protein VE01_08183 [Pseudogymnoascus verrucosus] ELR04545.1 hypothetical protein GMDG_06836 [Pseudogymnoascus destructans 20631-21] KFY69884.1 hypothetical protein V499_09669 [Pseudogymnoascus sp. VKM F-103] OAF60841.1 hypothetical protein VC83_02288 [Pseudogymnoascus destructans] OBT42330.1 hypothetical protein VE00_06452 [Pseudogymnoascus sp. WSF 3629] OBT68377.1 hypothetical protein VE03_02917 [Pseudogymnoascus sp. 23342-1-I1] OBT93950.1 hypothetical protein VE01_08183 [Pseudogymnoascus verrucosus] Length = 147 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E IE+K+ S +AKKRAQ+ +RR L DFERFKV+RLRKQARF+VRK+LA KAA Sbjct: 90 EKAGIEAKWQESAWAKKRAQKERRRALTDFERFKVLRLRKQARFEVRKSLAKVKAA 145 >KEQ65781.1 hypothetical protein M437DRAFT_18786, partial [Aureobasidium melanogenum CBS 110374] Length = 146 Score = 72.8 bits (177), Expect = 2e-13 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKA 296 E ++SK+NNS +AK R + KR+ L DFERFKVMRLRKQARF+VRK AAA+A Sbjct: 90 EKDGVDSKWNNSAWAKNRERSVKRKQLTDFERFKVMRLRKQARFEVRKQFAAARA 144 >EME49592.1 hypothetical protein DOTSEDRAFT_68390 [Dothistroma septosporum NZE10] Length = 144 Score = 72.4 bits (176), Expect = 2e-13 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = -1 Query: 451 EIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKA 296 +I+ K+ NS YAK+ ++ +R+ LNDFERFKVMRLRKQARF+VRK +A+AKA Sbjct: 93 KIDEKWTNSGYAKRLQKEARRKQLNDFERFKVMRLRKQARFEVRKAIASAKA 144 >KZM18827.1 structural constituent of ribosome [Ascochyta rabiei] Length = 146 Score = 72.4 bits (176), Expect = 3e-13 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E +++ KF+ S +AKKRA TKRR LNDFERFKVM+LRKQAR++V+KT A +A+ Sbjct: 88 EEHKVQQKFDESAWAKKRAAITKRRQLNDFERFKVMKLRKQARYEVQKTFAKIRAS 143 >XP_018003229.1 60S ribosomal protein L14-B [Phialophora attae] KPI43266.1 60S ribosomal protein L14-B [Phialophora attae] Length = 146 Score = 72.4 bits (176), Expect = 3e-13 Identities = 35/56 (62%), Positives = 44/56 (78%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 EAQ I+ K ++ +AKKR QQ KR NL+DFERFKVMRL+KQARF+V+K A KA+ Sbjct: 90 EAQNIDEKIADNTHAKKRVQQQKRSNLSDFERFKVMRLKKQARFEVKKAAAKIKAS 145 >OCK86824.1 60S ribosomal protein L14 [Cenococcum geophilum 1.58] Length = 148 Score = 72.4 bits (176), Expect = 3e-13 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 E++++E KF NS++A R + KRR LNDFERFKVM+LRKQARFQV+K LA +A+ Sbjct: 90 ESEKVEEKFENSNWALNRNRFAKRRQLNDFERFKVMKLRKQARFQVQKNLAKVRAS 145 >XP_016219231.1 hypothetical protein PV09_00260 [Verruconis gallopava] KIW09362.1 hypothetical protein PV09_00260 [Verruconis gallopava] Length = 147 Score = 72.0 bits (175), Expect = 4e-13 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -1 Query: 460 EAQEIESKFNNSDYAKKRAQQTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA 293 EA E+E K+ S +AK RA+ KRR LNDFERFKVMRLRKQ RF+ +K LA KA+ Sbjct: 91 EAAEVEKKWEESAFAKSRAKSAKRRQLNDFERFKVMRLRKQVRFEEKKQLAKIKAS 146