BLASTX nr result
ID: Papaver31_contig00056777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00056777 (613 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010253725.1| PREDICTED: exosome complex component MTR3 is... 66 2e-08 ref|XP_010253724.1| PREDICTED: exosome complex component MTR3 is... 66 2e-08 ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [V... 57 8e-06 >ref|XP_010253725.1| PREDICTED: exosome complex component MTR3 isoform X2 [Nelumbo nucifera] Length = 204 Score = 65.9 bits (159), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 613 APTTYSPSPSNKKQQSIFKDVDWVRPDGCRFHQYRP 506 APTTYSPSP+ KK+Q IFKDVDW+RPDG FHQ RP Sbjct: 8 APTTYSPSPTQKKRQPIFKDVDWIRPDGRGFHQCRP 43 >ref|XP_010253724.1| PREDICTED: exosome complex component MTR3 isoform X1 [Nelumbo nucifera] Length = 254 Score = 65.9 bits (159), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 613 APTTYSPSPSNKKQQSIFKDVDWVRPDGCRFHQYRP 506 APTTYSPSP+ KK+Q IFKDVDW+RPDG FHQ RP Sbjct: 8 APTTYSPSPTQKKRQPIFKDVDWIRPDGRGFHQCRP 43 >ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [Vitis vinifera] gi|147834996|emb|CAN61380.1| hypothetical protein VITISV_037546 [Vitis vinifera] gi|297746275|emb|CBI16331.3| unnamed protein product [Vitis vinifera] Length = 254 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -1 Query: 610 PTTYSPSPSNKKQQSIFKDVDWVRPDGCRFHQYRP 506 P+TYSPSP+ K ++ IF+DVDWVRPDG FHQ RP Sbjct: 9 PSTYSPSPAPKTKRPIFQDVDWVRPDGRGFHQCRP 43