BLASTX nr result
ID: Papaver31_contig00054429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00054429 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001190137.1| mitochondrial ribosomal protein L51/S25/CI-B... 59 1e-06 ref|XP_009790293.1| PREDICTED: 54S ribosomal protein L51, mitoch... 59 2e-06 ref|XP_009594110.1| PREDICTED: 54S ribosomal protein L51, mitoch... 56 9e-06 ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus... 56 9e-06 >ref|NP_001190137.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|332646430|gb|AEE79951.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 146 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = +1 Query: 4 FMKSVLPAFKEGNPQLEVFSELNRGKHPFLKELYSKILSCLCSRVHV--MLVLCIYTA 171 FM+S LPA KE NPQLEV +EL+RG+HP+LK +YS +S L + + + +L+L I A Sbjct: 29 FMESELPALKEKNPQLEVITELSRGQHPYLKGIYSMYISPLLNTILIQRLLILAISLA 86 >ref|XP_009790293.1| PREDICTED: 54S ribosomal protein L51, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 119 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 4 FMKSVLPAFKEGNPQLEVFSELNRGKHPFLKELY 105 FM+S LPAFKE NPQLEV +ELNRG+HPFLK LY Sbjct: 29 FMESELPAFKEQNPQLEVVTELNRGQHPFLKGLY 62 >ref|XP_009594110.1| PREDICTED: 54S ribosomal protein L51, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697170387|ref|XP_009594111.1| PREDICTED: 54S ribosomal protein L51, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 119 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 4 FMKSVLPAFKEGNPQLEVFSELNRGKHPFLKELY 105 FM+S LPA KE NPQLEV +ELNRG+HPFLK LY Sbjct: 29 FMESELPALKEQNPQLEVVTELNRGQHPFLKGLY 62 >ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus communis] gi|223529875|gb|EEF31806.1| 60S ribosomal protein L51, putative [Ricinus communis] Length = 119 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 4 FMKSVLPAFKEGNPQLEVFSELNRGKHPFLKELY 105 FM+S LP FKEGNPQLEV +ELNRG+HP LK Y Sbjct: 29 FMESHLPVFKEGNPQLEVITELNRGQHPLLKGFY 62