BLASTX nr result
ID: Papaver31_contig00053231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00053231 (820 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514474.1| conserved hypothetical protein [Ricinus comm... 61 1e-06 ref|XP_003579944.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 9e-06 >ref|XP_002514474.1| conserved hypothetical protein [Ricinus communis] gi|223546373|gb|EEF47874.1| conserved hypothetical protein [Ricinus communis] Length = 521 Score = 60.8 bits (146), Expect = 1e-06 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = -2 Query: 807 RGDFVMVQCSVGYKDAISLCSINEGSQVLNIELEESNDDVVLEVIGERNVHMSGFYL 637 + F VQCS+G K IS+C++N+GS L E EES +D+V V G R VH+SG+YL Sbjct: 42 KNTFTYVQCSIGGKPPISICAVNKGSLGLEFEFEES-EDIVFTVKGPREVHLSGYYL 97 >ref|XP_003579944.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Brachypodium distachyon] gi|944045821|gb|KQJ81462.1| hypothetical protein BRADI_5g00880 [Brachypodium distachyon] Length = 400 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/66 (40%), Positives = 48/66 (72%), Gaps = 2/66 (3%) Frame = -2 Query: 792 MVQCSVGYKDAISLCSINEG-SQVLNIELE-ESNDDVVLEVIGERNVHMSGFYLGHNDRC 619 +VQC+VG K + LCS+N +++ ++E+E E ++DV+ V+G+ +VH+SG+YL + RC Sbjct: 42 VVQCNVGNKTPVKLCSLNPRLAEMCHLEIELEEDEDVLFSVLGQSSVHLSGYYLHPSTRC 101 Query: 618 VSMGKE 601 + G+E Sbjct: 102 NAGGEE 107