BLASTX nr result
ID: Papaver31_contig00053169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00053169 (604 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006378779.1| hypothetical protein POPTR_0010s23300g [Popu... 59 3e-06 >ref|XP_006378779.1| hypothetical protein POPTR_0010s23300g [Populus trichocarpa] gi|550330434|gb|ERP56576.1| hypothetical protein POPTR_0010s23300g [Populus trichocarpa] Length = 104 Score = 58.5 bits (140), Expect = 3e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 374 GGEFESCMPKGFRHSSAPSQFVNYGVVGSTMCTTS 270 GGE E+C+PKGF H+SAPS+++NY +GSTMC TS Sbjct: 64 GGEVENCLPKGFHHNSAPSRYINYHPLGSTMCATS 98