BLASTX nr result
ID: Papaver31_contig00051547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00051547 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014510340.1| PREDICTED: actin-related protein 2/3 complex... 60 6e-07 ref|XP_010058076.1| PREDICTED: actin-related protein 2/3 complex... 60 6e-07 ref|XP_007156295.1| hypothetical protein PHAVU_003G274500g [Phas... 60 6e-07 ref|XP_006843345.1| PREDICTED: actin-related protein 2/3 complex... 60 6e-07 ref|XP_009400559.1| PREDICTED: actin-related protein 2/3 complex... 60 8e-07 ref|XP_009400558.1| PREDICTED: actin-related protein 2/3 complex... 60 8e-07 ref|XP_006859077.1| PREDICTED: actin-related protein 2/3 complex... 59 1e-06 ref|XP_002284770.1| PREDICTED: actin-related protein 2/3 complex... 59 1e-06 ref|XP_011020960.1| PREDICTED: actin-related protein 2/3 complex... 59 2e-06 ref|XP_011020956.1| PREDICTED: actin-related protein 2/3 complex... 59 2e-06 ref|XP_010913434.1| PREDICTED: actin-related protein 2/3 complex... 59 2e-06 ref|XP_008798451.1| PREDICTED: actin-related protein 2/3 complex... 59 2e-06 ref|XP_008439412.1| PREDICTED: actin-related protein 2/3 complex... 59 2e-06 ref|XP_004134509.1| PREDICTED: actin-related protein 2/3 complex... 59 2e-06 gb|AFK40144.1| unknown [Lotus japonicus] 59 2e-06 gb|KRH07553.1| hypothetical protein GLYMA_16G094500 [Glycine max] 58 2e-06 gb|KHN41332.1| Actin-related protein 2/3 complex subunit 2 [Glyc... 58 2e-06 ref|XP_003547807.1| PREDICTED: actin-related protein 2/3 complex... 58 2e-06 ref|XP_011004302.1| PREDICTED: actin-related protein 2/3 complex... 58 3e-06 ref|XP_011004301.1| PREDICTED: actin-related protein 2/3 complex... 58 3e-06 >ref|XP_014510340.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Vigna radiata var. radiata] Length = 324 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQALDRAKP+V Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPDV 298 >ref|XP_010058076.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Eucalyptus grandis] gi|629110442|gb|KCW75588.1| hypothetical protein EUGRSUZ_E04332 [Eucalyptus grandis] Length = 324 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQALDRAKP+V Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPDV 298 >ref|XP_007156295.1| hypothetical protein PHAVU_003G274500g [Phaseolus vulgaris] gi|561029649|gb|ESW28289.1| hypothetical protein PHAVU_003G274500g [Phaseolus vulgaris] Length = 324 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQALDRAKP+V Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPDV 298 >ref|XP_006843345.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Amborella trichopoda] gi|548845712|gb|ERN05020.1| hypothetical protein AMTR_s00053p00038610 [Amborella trichopoda] Length = 314 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLI+ALDRAKPEV Sbjct: 269 VKCSEGFMHTRMRRRVESLIEALDRAKPEV 298 >ref|XP_009400559.1| PREDICTED: actin-related protein 2/3 complex subunit 2A isoform X2 [Musa acuminata subsp. malaccensis] Length = 324 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVESLIQALDRAKPE Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPE 297 >ref|XP_009400558.1| PREDICTED: actin-related protein 2/3 complex subunit 2A isoform X1 [Musa acuminata subsp. malaccensis] Length = 325 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVESLIQALDRAKPE Sbjct: 270 VKCSEGFMHTRMRRRVESLIQALDRAKPE 298 >ref|XP_006859077.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Amborella trichopoda] gi|548863189|gb|ERN20544.1| hypothetical protein AMTR_s00068p00203870 [Amborella trichopoda] Length = 314 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLI+ALDRAKP+V Sbjct: 269 VKCSEGFMHTRMRRRVESLIEALDRAKPDV 298 >ref|XP_002284770.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Vitis vinifera] gi|297737660|emb|CBI26861.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQALDRAKP++ Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPDL 298 >ref|XP_011020960.1| PREDICTED: actin-related protein 2/3 complex subunit 2A-like isoform X4 [Populus euphratica] gi|743824569|ref|XP_011022286.1| PREDICTED: actin-related protein 2/3 complex subunit 2A-like isoform X4 [Populus euphratica] Length = 275 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVES+IQALDRAKP V Sbjct: 220 VKCSEGFMHTRMRRRVESMIQALDRAKPRV 249 >ref|XP_011020956.1| PREDICTED: actin-related protein 2/3 complex subunit 2A-like isoform X1 [Populus euphratica] gi|743824555|ref|XP_011022283.1| PREDICTED: actin-related protein 2/3 complex subunit 2A-like isoform X1 [Populus euphratica] Length = 324 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVES+IQALDRAKP V Sbjct: 269 VKCSEGFMHTRMRRRVESMIQALDRAKPRV 298 >ref|XP_010913434.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Elaeis guineensis] Length = 321 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVESLIQALDRAKP+ Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPD 297 >ref|XP_008798451.1| PREDICTED: actin-related protein 2/3 complex subunit 2A, partial [Phoenix dactylifera] Length = 373 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVESLIQALDRAKP+ Sbjct: 321 VKCSEGFMHTRMRRRVESLIQALDRAKPD 349 >ref|XP_008439412.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Cucumis melo] Length = 320 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVESLIQALDRAKP+ Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPD 297 >ref|XP_004134509.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Cucumis sativus] gi|700194346|gb|KGN49550.1| hypothetical protein Csa_6G538790 [Cucumis sativus] Length = 320 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVESLIQALDRAKP+ Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKPD 297 >gb|AFK40144.1| unknown [Lotus japonicus] Length = 324 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPE 4 ++CSEGFMHTRMRRRVE+LIQALDRAKPE Sbjct: 269 VKCSEGFMHTRMRRRVETLIQALDRAKPE 297 >gb|KRH07553.1| hypothetical protein GLYMA_16G094500 [Glycine max] Length = 275 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQAL+RAKP+V Sbjct: 220 VKCSEGFMHTRMRRRVESLIQALNRAKPDV 249 >gb|KHN41332.1| Actin-related protein 2/3 complex subunit 2 [Glycine soja] Length = 288 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQAL+RAKP+V Sbjct: 234 VKCSEGFMHTRMRRRVESLIQALNRAKPDV 263 >ref|XP_003547807.1| PREDICTED: actin-related protein 2/3 complex subunit 2A [Glycine max] Length = 320 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKPEV 1 ++CSEGFMHTRMRRRVESLIQAL+RAKP+V Sbjct: 265 VKCSEGFMHTRMRRRVESLIQALNRAKPDV 294 >ref|XP_011004302.1| PREDICTED: actin-related protein 2/3 complex subunit 2A-like isoform X2 [Populus euphratica] Length = 318 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKP 7 ++CSEGFMHTRMRRRVESLIQALDRAKP Sbjct: 263 VKCSEGFMHTRMRRRVESLIQALDRAKP 290 >ref|XP_011004301.1| PREDICTED: actin-related protein 2/3 complex subunit 2A-like isoform X1 [Populus euphratica] Length = 324 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 90 IQCSEGFMHTRMRRRVESLIQALDRAKP 7 ++CSEGFMHTRMRRRVESLIQALDRAKP Sbjct: 269 VKCSEGFMHTRMRRRVESLIQALDRAKP 296