BLASTX nr result
ID: Papaver31_contig00050450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00050450 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007138307.1| hypothetical protein PHAVU_009G197600g [Phas... 57 5e-06 >ref|XP_007138307.1| hypothetical protein PHAVU_009G197600g [Phaseolus vulgaris] gi|561011394|gb|ESW10301.1| hypothetical protein PHAVU_009G197600g [Phaseolus vulgaris] Length = 414 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +1 Query: 1 GLYGTTKQDVFWTTEKREVPTAYKLFTGSA*MEYEHPW 114 GLYG K DVFW +EKR VPTAYKLFTGSA M P+ Sbjct: 217 GLYGLQKSDVFWVSEKRNVPTAYKLFTGSAWMMLSRPF 254