BLASTX nr result
ID: Papaver31_contig00050116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00050116 (468 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014495829.1| PREDICTED: carbon catabolite repressor prote... 45 1e-05 >ref|XP_014495829.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Vigna radiata var. radiata] gi|950952023|ref|XP_014495830.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Vigna radiata var. radiata] Length = 599 Score = 45.1 bits (105), Expect(2) = 1e-05 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -2 Query: 452 GHIYAANGRATFFRRNRFSHVKKYEI 375 G+IY +G ATFFRR+RFSHVKKYE+ Sbjct: 334 GNIYTIDGCATFFRRDRFSHVKKYEV 359 Score = 30.8 bits (68), Expect(2) = 1e-05 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = -1 Query: 288 VEFNKAA*SLTDSVVLITRRKCRTYKIFENLKFDIEVME 172 VEFNKAA SLTD+V+ T++K ++ ++ I V+E Sbjct: 359 VEFNKAAQSLTDAVIPTTQKKTALNRLVKDNVALIVVLE 397