BLASTX nr result
ID: Papaver31_contig00050077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00050077 (1001 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008664845.1| PREDICTED: endoribonuclease Dicer homolog 3b... 50 8e-07 >ref|XP_008664845.1| PREDICTED: endoribonuclease Dicer homolog 3b-like isoform X2 [Zea mays] Length = 1572 Score = 49.7 bits (117), Expect(2) = 8e-07 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 5/58 (8%) Frame = -2 Query: 247 CAI*FT--KTVCSYVQSSG*AR*RDSRYIMMLERYLLPRQFLNFG---GAYECV*IIP 89 C I F +TVCSYVQS G AR S Y++M+ERY LP+ G G+Y+C +P Sbjct: 485 CVIRFDLPRTVCSYVQSRGRARKSSSSYVLMIERYYLPKPCFEVGLKDGSYQCTLTMP 542 Score = 32.0 bits (71), Expect(2) = 8e-07 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 54 VCLEACKKLHQVGVYDE 4 VCLEACKKLH++G D+ Sbjct: 565 VCLEACKKLHELGELDD 581