BLASTX nr result
ID: Papaver31_contig00049947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00049947 (826 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004496040.1| PREDICTED: uncharacterized protein At5g06450... 50 5e-07 >ref|XP_004496040.1| PREDICTED: uncharacterized protein At5g06450-like [Cicer arietinum] Length = 196 Score = 50.1 bits (118), Expect(2) = 5e-07 Identities = 26/56 (46%), Positives = 31/56 (55%) Frame = -1 Query: 556 STIATLHLCHGSHCFVIHLPRLDSIPNSLIRFLGDATIRFLRVDISQSFTKLAGEY 389 S ATL LC+G C VI L LDS+PNSL+ FL + F+ V I KL Y Sbjct: 58 SECATLCLCNGHSCLVIQLRHLDSVPNSLLNFLRMPNLTFVGVGIKDDMAKLEETY 113 Score = 32.0 bits (71), Expect(2) = 5e-07 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 696 NGISIVTIVTNDPSKVEVVLAELRVSVAATGDRVVGLDINFS 571 NG I T VT+D +KV+ +L TG +V+G D ++ Sbjct: 10 NGARIETTVTDDQAKVDNILGSFLHHANCTGTKVIGFDTEWT 51