BLASTX nr result
ID: Papaver31_contig00049737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00049737 (417 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009773471.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_009622993.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 emb|CDP00435.1| unnamed protein product [Coffea canephora] 64 6e-08 ref|XP_012847748.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-08 ref|XP_004229722.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010258062.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 gb|KDO70376.1| hypothetical protein CISIN_1g038801mg [Citrus sin... 61 3e-07 ref|XP_006354656.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_011018666.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_006484205.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_006437925.1| hypothetical protein CICLE_v10033305mg [Citr... 60 5e-07 ref|XP_010091575.1| hypothetical protein L484_026421 [Morus nota... 60 8e-07 ref|XP_004490216.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_004490197.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_010936488.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_010470906.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_012067775.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_009416567.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 gb|KDP41302.1| hypothetical protein JCGZ_15709 [Jatropha curcas] 58 2e-06 ref|XP_006391035.1| hypothetical protein EUTSA_v10018238mg [Eutr... 58 3e-06 >ref|XP_009773471.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290 [Nicotiana sylvestris] Length = 655 Score = 64.7 bits (156), Expect = 3e-08 Identities = 38/67 (56%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPT-PQTLNSTPKTLGADCKSSLESNLQTSLDNQN 394 P L+SFLQPSIF+L +T Q P PT PQ + TP TL + KS+LES LQ S++ N Sbjct: 21 PTLYSFLQPSIFSLKRT--QPPSSTTPTKPQ--DQTPLTLTQEHKSNLESTLQNSINTDN 76 Query: 395 TDEAWKS 415 TDEAWKS Sbjct: 77 TDEAWKS 83 >ref|XP_009622993.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Nicotiana tomentosiformis] Length = 655 Score = 63.5 bits (153), Expect = 6e-08 Identities = 38/67 (56%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPT-PQTLNSTPKTLGADCKSSLESNLQTSLDNQN 394 P L+SFLQPSIF+L +T Q P PT PQ + TP TL + KS+LES LQTS++ N Sbjct: 21 PTLYSFLQPSIFSLKRT--QPPSSTTPTKPQ--DQTPLTLTQEHKSNLESTLQTSINTNN 76 Query: 395 TDEAWKS 415 TDEAW S Sbjct: 77 TDEAWIS 83 >emb|CDP00435.1| unnamed protein product [Coffea canephora] Length = 969 Score = 63.5 bits (153), Expect = 6e-08 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQNT 397 P L+SFLQPS+F L K + ++P+ P PQ ST K L D K++LES L++SL +QN Sbjct: 21 PTLYSFLQPSVFAL-KRSNKEPLNPLPKPQ--ESTSKGLSQDHKTTLESTLESSLISQNI 77 Query: 398 DEAWKS 415 DEAWKS Sbjct: 78 DEAWKS 83 >ref|XP_012847748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290 [Erythranthe guttatus] gi|604316671|gb|EYU28863.1| hypothetical protein MIMGU_mgv1a017797mg [Erythranthe guttata] Length = 656 Score = 63.2 bits (152), Expect = 8e-08 Identities = 37/68 (54%), Positives = 42/68 (61%), Gaps = 2/68 (2%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTT--QQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQ 391 P L+SFLQPSIF+L +TT QQPI P NS KS+LES LQ SL + Sbjct: 22 PTLYSFLQPSIFSLKRTTNHRQQPIIPPP-----NSQQNPASNPQKSNLESTLQQSLSDN 76 Query: 392 NTDEAWKS 415 NTDEAWKS Sbjct: 77 NTDEAWKS 84 >ref|XP_004229722.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Solanum lycopersicum] gi|723660247|ref|XP_010325129.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Solanum lycopersicum] Length = 654 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/66 (53%), Positives = 43/66 (65%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQNT 397 P L+SFLQPSIF+L TT+ P P P + TP TL + KS+LES L S+ + NT Sbjct: 21 PTLYSFLQPSIFSLK--TTESPSTTPPKPH--DQTPLTLTQEHKSNLESTLLDSIRSNNT 76 Query: 398 DEAWKS 415 DEAWKS Sbjct: 77 DEAWKS 82 >ref|XP_010258062.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Nelumbo nucifera] Length = 651 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/64 (51%), Positives = 42/64 (65%) Frame = +2 Query: 224 LHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQNTDE 403 L+SFLQPS+F L KT P P+ STP L + K++LES+L SLDN++TDE Sbjct: 23 LYSFLQPSVFALKKTPL-------PPPKPPESTPLPLTQEHKTALESSLLASLDNRDTDE 75 Query: 404 AWKS 415 AWKS Sbjct: 76 AWKS 79 >gb|KDO70376.1| hypothetical protein CISIN_1g038801mg [Citrus sinensis] Length = 662 Score = 61.2 bits (147), Expect = 3e-07 Identities = 37/71 (52%), Positives = 45/71 (63%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSL 382 +PETP L+SFLQPSIF+L + + QQ PT Q +TL D +SLE+NL SL Sbjct: 24 SPETPS-LYSFLQPSIFSLKRKSLQQDPPNSPTQQ---QQQQTLTQDNITSLETNLHKSL 79 Query: 383 DNQNTDEAWKS 415 NTDEAWKS Sbjct: 80 LTNNTDEAWKS 90 >ref|XP_006354656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like isoform X1 [Solanum tuberosum] gi|565376327|ref|XP_006354657.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like isoform X2 [Solanum tuberosum] Length = 654 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/66 (51%), Positives = 43/66 (65%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQNT 397 P L+SFLQPSIF+L + + P P P + TP TL + KS+LES LQ S+ + NT Sbjct: 21 PTLYSFLQPSIFSLKRY--ESPSTTPPKPH--DQTPLTLTQEHKSNLESTLQDSIKSNNT 76 Query: 398 DEAWKS 415 DEAWKS Sbjct: 77 DEAWKS 82 >ref|XP_011018666.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290 [Populus euphratica] Length = 654 Score = 60.5 bits (145), Expect = 5e-07 Identities = 36/71 (50%), Positives = 42/71 (59%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSL 382 TPETP L+SFLQP+IF+L KT P P T TPK L D ++LES L SL Sbjct: 17 TPETPT-LYSFLQPTIFSLKKTP---PSITNPATTTNRQTPKILTQDHITNLESTLHRSL 72 Query: 383 DNQNTDEAWKS 415 NT+EAW S Sbjct: 73 ITNNTNEAWAS 83 >ref|XP_006484205.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Citrus sinensis] Length = 666 Score = 60.5 bits (145), Expect = 5e-07 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPK-TLGADCKSSLESNLQTS 379 +PETP L+SFLQPSIF+L + QQ PT Q + TL D +SLE+NL S Sbjct: 24 SPETPS-LYSFLQPSIFSLKPKSPQQDPTNSPTQQQQQQQQQQTLTQDNITSLETNLHKS 82 Query: 380 LDNQNTDEAWKS 415 L NTDEAWKS Sbjct: 83 LLTNNTDEAWKS 94 >ref|XP_006437925.1| hypothetical protein CICLE_v10033305mg [Citrus clementina] gi|557540121|gb|ESR51165.1| hypothetical protein CICLE_v10033305mg [Citrus clementina] Length = 948 Score = 60.5 bits (145), Expect = 5e-07 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPK-TLGADCKSSLESNLQTS 379 +PETP L+SFLQPSIF+L + QQ PT Q + TL D +SLE+NL S Sbjct: 24 SPETPS-LYSFLQPSIFSLKPKSPQQDPTNSPTQQQQQQQQQQTLTQDNITSLETNLHKS 82 Query: 380 LDNQNTDEAWKS 415 L NTDEAWKS Sbjct: 83 LLTNNTDEAWKS 94 >ref|XP_010091575.1| hypothetical protein L484_026421 [Morus notabilis] gi|703163104|ref|XP_010113228.1| hypothetical protein L484_000401 [Morus notabilis] gi|587854816|gb|EXB44841.1| hypothetical protein L484_026421 [Morus notabilis] gi|587991060|gb|EXC75276.1| hypothetical protein L484_000401 [Morus notabilis] Length = 660 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQNT 397 P L+SFLQPS+F L + + P + PKTL D +SLE+NLQ SL +T Sbjct: 23 PTLYSFLQPSVFALRRESHPPPSSQHAAANLPTEPPKTLTLDDVNSLETNLQKSLLTSDT 82 Query: 398 DEAWKS 415 DEAWKS Sbjct: 83 DEAWKS 88 >ref|XP_004490216.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290 [Cicer arietinum] Length = 655 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQP-IFKEPTPQTLNSTPKTLGADCKSSLESNLQTS 379 TPE P L+SFLQP++F+LNK ++P PTP++L+ TP + SSLE+ L S Sbjct: 18 TPEIPS-LYSFLQPTLFSLNKPNFEEPQNLPTPTPKSLSLTPHQI-----SSLETTLHKS 71 Query: 380 LDNQNTDEAWKS 415 L TDEAWKS Sbjct: 72 LLTTQTDEAWKS 83 >ref|XP_004490197.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Cicer arietinum] Length = 655 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQP-IFKEPTPQTLNSTPKTLGADCKSSLESNLQTS 379 TPE P L+SFLQP++F+LNK ++P PTP++L+ TP + SSLE+ L S Sbjct: 18 TPEIPS-LYSFLQPTLFSLNKPNFEEPQNLPTPTPKSLSLTPHQI-----SSLETTLHKS 71 Query: 380 LDNQNTDEAWKS 415 L TDEAWKS Sbjct: 72 LLTTQTDEAWKS 83 >ref|XP_010936488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290 [Elaeis guineensis] Length = 656 Score = 58.9 bits (141), Expect = 1e-06 Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTT-TQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQN 394 P L+SFLQPSIF L KT P P PQT N P+TL D S+LES+LQ+SL + + Sbjct: 24 PTLYSFLQPSIFALRKTNPNPPPPSPSPPPQTPN--PQTLTPDA-SALESDLQSSLQSGH 80 Query: 395 TDEAWKS 415 TD AW S Sbjct: 81 TDRAWSS 87 >ref|XP_010470906.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Camelina sativa] Length = 659 Score = 58.5 bits (140), Expect = 2e-06 Identities = 35/71 (49%), Positives = 43/71 (60%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSL 382 +PE+P L+SFL+PS+F+ NK T P P PKTL D KS+ ES L SL Sbjct: 19 SPESPS-LYSFLKPSLFS-NKPITLTPSLSPP------QNPKTLSQDQKSTFESTLHDSL 70 Query: 383 DNQNTDEAWKS 415 QNTDEAWK+ Sbjct: 71 TAQNTDEAWKA 81 >ref|XP_012067775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290 [Jatropha curcas] Length = 662 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/74 (45%), Positives = 41/74 (55%), Gaps = 3/74 (4%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNK---TTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQ 373 TP PP L+SFLQPSIF K TTT + PQT+N P D +LES + Sbjct: 21 TPPPPPSLYSFLQPSIFAAKKPTSTTTNPTTIQSADPQTVNPLP----LDQIQTLESTIH 76 Query: 374 TSLDNQNTDEAWKS 415 SL +TD+AWKS Sbjct: 77 DSLLTNDTDQAWKS 90 >ref|XP_009416567.1| PREDICTED: pentatricopeptide repeat-containing protein At1g69290-like [Musa acuminata subsp. malaccensis] Length = 668 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = +2 Query: 218 PILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSLDNQNT 397 P L+SFLQPSIF + T Q P+P +L+S KTL + ++LES+L ++L + T Sbjct: 34 PTLYSFLQPSIFAIRTTKGPQNPPPSPSPTSLSSPGKTLTPEDTAALESDLLSALRSSRT 93 Query: 398 DEAWKS 415 D+AWKS Sbjct: 94 DDAWKS 99 >gb|KDP41302.1| hypothetical protein JCGZ_15709 [Jatropha curcas] Length = 689 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/74 (45%), Positives = 41/74 (55%), Gaps = 3/74 (4%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNK---TTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQ 373 TP PP L+SFLQPSIF K TTT + PQT+N P D +LES + Sbjct: 48 TPPPPPSLYSFLQPSIFAAKKPTSTTTNPTTIQSADPQTVNPLP----LDQIQTLESTIH 103 Query: 374 TSLDNQNTDEAWKS 415 SL +TD+AWKS Sbjct: 104 DSLLTNDTDQAWKS 117 >ref|XP_006391035.1| hypothetical protein EUTSA_v10018238mg [Eutrema salsugineum] gi|557087469|gb|ESQ28321.1| hypothetical protein EUTSA_v10018238mg [Eutrema salsugineum] Length = 661 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/71 (47%), Positives = 45/71 (63%) Frame = +2 Query: 203 TPETPPILHSFLQPSIFTLNKTTTQQPIFKEPTPQTLNSTPKTLGADCKSSLESNLQTSL 382 +PE+P L+SFL+PS+F+ +K T P P TPKTL D +SS+ES L SL Sbjct: 18 SPESPS-LYSFLKPSLFS-HKPNTLTPSLSPP------QTPKTLSQDQRSSIESALHDSL 69 Query: 383 DNQNTDEAWKS 415 + NTDEAWK+ Sbjct: 70 ASHNTDEAWKA 80