BLASTX nr result
ID: Papaver31_contig00049734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00049734 (897 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010650357.1| PREDICTED: F-box protein At5g65850-like [Vit... 59 5e-06 emb|CAN60954.1| hypothetical protein VITISV_008876 [Vitis vinifera] 59 5e-06 >ref|XP_010650357.1| PREDICTED: F-box protein At5g65850-like [Vitis vinifera] Length = 373 Score = 58.9 bits (141), Expect = 5e-06 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 2/95 (2%) Frame = -1 Query: 897 YDPATKEYKVLALWNLHHNRVVCEILTVRRNSWRRI-DGIPSISPHDILCSVYVNGSIYL 721 +DP+TK YK+L +W N ++CEILT+ +WR I DG+ +C +NG+IY Sbjct: 163 FDPSTKTYKILKVWFERFNSIMCEILTLGSRAWRIIKDGLEYTLEAKGIC---LNGTIYW 219 Query: 720 LSANNYLLKNQYANRPLTQT-LIEFNVGSEKFRIV 619 A + + Y + + Q +I F+VG EKFR V Sbjct: 220 ADARH--ISEDYPHFVVMQNRVIAFDVGEEKFRSV 252 >emb|CAN60954.1| hypothetical protein VITISV_008876 [Vitis vinifera] Length = 862 Score = 58.9 bits (141), Expect = 5e-06 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 2/95 (2%) Frame = -1 Query: 897 YDPATKEYKVLALWNLHHNRVVCEILTVRRNSWRRI-DGIPSISPHDILCSVYVNGSIYL 721 +DP+TK YK+L +W N ++CEILT+ +WR I DG+ +C +NG+IY Sbjct: 623 FDPSTKTYKILKVWFERFNSIMCEILTLGXRAWRIIKDGLEYTLEAKGIC---LNGTIYW 679 Query: 720 LSANNYLLKNQYANRPLTQT-LIEFNVGSEKFRIV 619 A + + Y + + Q +I F+VG EKFR V Sbjct: 680 ADARH--ISEDYPHFVVMQNRVIAFDVGEEKFRSV 712