BLASTX nr result
ID: Papaver31_contig00047328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00047328 (536 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010272143.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-12 ref|XP_006600662.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-12 ref|XP_003549648.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-12 gb|KRH03385.1| hypothetical protein GLYMA_17G094300 [Glycine max] 60 1e-12 ref|XP_013457842.1| PPR containing plant-like protein [Medicago ... 61 2e-12 ref|XP_010037616.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-12 ref|XP_009369399.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-12 ref|XP_008393129.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-12 ref|XP_010428477.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-12 ref|XP_010471579.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-12 ref|XP_010471578.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-12 ref|XP_010471577.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-12 ref|XP_010416343.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-12 ref|XP_008367545.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 58 5e-12 ref|XP_013649954.1| PREDICTED: pentatricopeptide repeat-containi... 61 6e-12 ref|XP_009106139.1| PREDICTED: pentatricopeptide repeat-containi... 61 6e-12 ref|XP_009106140.1| PREDICTED: pentatricopeptide repeat-containi... 61 6e-12 ref|XP_013649956.1| PREDICTED: pentatricopeptide repeat-containi... 61 6e-12 ref|XP_013589728.1| PREDICTED: pentatricopeptide repeat-containi... 61 7e-12 ref|XP_013589729.1| PREDICTED: pentatricopeptide repeat-containi... 61 7e-12 >ref|XP_010272143.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic [Nelumbo nucifera] Length = 878 Score = 58.9 bits (141), Expect(4) = 1e-12 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIELYLV 42 IS SILTY+++I+ C RGGL+WE LLGLF++ RH+GI+ LV Sbjct: 220 ISPSILTYNTVINSCARGGLEWEGLLGLFAEMRHEGIQPDLV 261 Score = 31.2 bits (69), Expect(4) = 1e-12 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 E+FDEMP+HGV+RS F Sbjct: 175 EIFDEMPTHGVARSVF 190 Score = 25.4 bits (54), Expect(4) = 1e-12 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A SR LGDEAEM Sbjct: 265 TLLCACGSRGLGDEAEM 281 Score = 22.7 bits (47), Expect(4) = 1e-12 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V SFTALINA G Sbjct: 187 RSVFSFTALINAYG 200 >ref|XP_006600662.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like isoform X2 [Glycine max] Length = 860 Score = 60.1 bits (144), Expect(3) = 1e-12 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 +S SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 202 VSPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 239 Score = 31.6 bits (70), Expect(3) = 1e-12 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = -2 Query: 265 REVFDEMPSHGVSRSGFIH 209 REVFDEMPS+GV+R+ +++ Sbjct: 156 REVFDEMPSNGVARTVYVY 174 Score = 27.3 bits (59), Expect(3) = 1e-12 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLLGA + R LGDEAEM Sbjct: 247 TLLGACAHRGLGDEAEM 263 >ref|XP_003549648.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like isoform X1 [Glycine max] gi|947053931|gb|KRH03384.1| hypothetical protein GLYMA_17G094300 [Glycine max] Length = 859 Score = 60.1 bits (144), Expect(3) = 1e-12 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 +S SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 202 VSPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 239 Score = 31.6 bits (70), Expect(3) = 1e-12 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = -2 Query: 265 REVFDEMPSHGVSRSGFIH 209 REVFDEMPS+GV+R+ +++ Sbjct: 156 REVFDEMPSNGVARTVYVY 174 Score = 27.3 bits (59), Expect(3) = 1e-12 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLLGA + R LGDEAEM Sbjct: 247 TLLGACAHRGLGDEAEM 263 >gb|KRH03385.1| hypothetical protein GLYMA_17G094300 [Glycine max] Length = 748 Score = 60.1 bits (144), Expect(3) = 1e-12 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 +S SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 202 VSPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 239 Score = 31.6 bits (70), Expect(3) = 1e-12 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = -2 Query: 265 REVFDEMPSHGVSRSGFIH 209 REVFDEMPS+GV+R+ +++ Sbjct: 156 REVFDEMPSNGVARTVYVY 174 Score = 27.3 bits (59), Expect(3) = 1e-12 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLLGA + R LGDEAEM Sbjct: 247 TLLGACAHRGLGDEAEM 263 >ref|XP_013457842.1| PPR containing plant-like protein [Medicago truncatula] gi|657390325|gb|KEH31873.1| PPR containing plant-like protein [Medicago truncatula] Length = 862 Score = 60.8 bits (146), Expect(3) = 2e-12 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -1 Query: 185 SIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 S++ +S SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 198 SMKQERVSPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 241 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 265 REVFDEMPSHGVSRSGFIH 209 REVFDEMPS GV+RS F + Sbjct: 158 REVFDEMPSQGVARSVFAY 176 Score = 25.0 bits (53), Expect(3) = 2e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 249 TLLSACAHRGLGDEAEM 265 >ref|XP_010037616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic [Eucalyptus grandis] gi|629082906|gb|KCW49351.1| hypothetical protein EUGRSUZ_K02896 [Eucalyptus grandis] Length = 861 Score = 58.2 bits (139), Expect(3) = 2e-12 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIELYLV 42 +S SILTY+++I+ C RGGLDWE LL LF++ RH+GI+ LV Sbjct: 209 VSPSILTYNTVINACARGGLDWEGLLDLFAEMRHEGIQPDLV 250 Score = 32.7 bits (73), Expect(3) = 2e-12 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 265 REVFDEMPSHGVSRSGF 215 RE+FDEMPS+GVSRS F Sbjct: 163 REIFDEMPSNGVSRSVF 179 Score = 26.9 bits (58), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A S+R LGDEAEM Sbjct: 254 TLLSACSNRGLGDEAEM 270 >ref|XP_009369399.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic [Pyrus x bretschneideri] Length = 876 Score = 58.9 bits (141), Expect(4) = 3e-12 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIELYLV 42 +S SILTY+ +++ C RGGLDWE LLGLF++ RH+GI+ LV Sbjct: 218 VSPSILTYNIVLNACARGGLDWEGLLGLFAEMRHEGIQPDLV 259 Score = 28.5 bits (62), Expect(4) = 3e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV RS F Sbjct: 173 EVFDEMPSQGVVRSVF 188 Score = 25.4 bits (54), Expect(4) = 3e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 263 TLLSACAGRGLGDEAEM 279 Score = 23.9 bits (50), Expect(4) = 3e-12 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -3 Query: 228 RGVVSFTALINA---*G*YKVSLDF 163 R V S+TALINA G Y+ SL+F Sbjct: 185 RSVFSYTALINAYGRNGQYETSLEF 209 >ref|XP_008393129.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Malus domestica] Length = 1062 Score = 58.2 bits (139), Expect(4) = 5e-12 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 158 SILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIELYLV 42 SILTY+++++ C RGGLDWE LLGLF++ RH+GI+ LV Sbjct: 407 SILTYNTVLNACARGGLDWEGLLGLFAEMRHEGIQPDLV 445 Score = 28.5 bits (62), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV RS F Sbjct: 359 EVFDEMPSQGVVRSVF 374 Score = 25.4 bits (54), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 449 TLLSACAGRGLGDEAEM 465 Score = 23.9 bits (50), Expect(4) = 5e-12 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -3 Query: 228 RGVVSFTALINA---*G*YKVSLDF 163 R V S+TALINA G Y+ SL+F Sbjct: 371 RSVFSYTALINAYGRNGQYETSLEF 395 >ref|XP_010428477.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Camelina sativa] Length = 864 Score = 60.5 bits (145), Expect(4) = 5e-12 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 208 ISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 245 Score = 29.3 bits (64), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMP GVSRS F Sbjct: 163 EVFDEMPGQGVSRSVF 178 Score = 24.6 bits (52), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 253 TLLSACAIRGLGDEAEM 269 Score = 21.6 bits (44), Expect(4) = 5e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 175 RSVFSYTALINAYG 188 >ref|XP_010471579.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X3 [Camelina sativa] gi|727597185|ref|XP_010471580.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X4 [Camelina sativa] Length = 863 Score = 60.5 bits (145), Expect(4) = 5e-12 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 207 ISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.3 bits (64), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMP GVSRS F Sbjct: 162 EVFDEMPGQGVSRSVF 177 Score = 24.6 bits (52), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 252 TLLSACAIRGLGDEAEM 268 Score = 21.6 bits (44), Expect(4) = 5e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_010471578.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X2 [Camelina sativa] Length = 863 Score = 60.5 bits (145), Expect(4) = 5e-12 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 207 ISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.3 bits (64), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMP GVSRS F Sbjct: 162 EVFDEMPGQGVSRSVF 177 Score = 24.6 bits (52), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 252 TLLSACAIRGLGDEAEM 268 Score = 21.6 bits (44), Expect(4) = 5e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_010471577.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X1 [Camelina sativa] Length = 863 Score = 60.5 bits (145), Expect(4) = 5e-12 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 207 ISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.3 bits (64), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMP GVSRS F Sbjct: 162 EVFDEMPGQGVSRSVF 177 Score = 24.6 bits (52), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 252 TLLSACAIRGLGDEAEM 268 Score = 21.6 bits (44), Expect(4) = 5e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_010416343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Camelina sativa] Length = 863 Score = 60.5 bits (145), Expect(4) = 5e-12 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 167 ISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 207 ISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.3 bits (64), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMP GVSRS F Sbjct: 162 EVFDEMPGQGVSRSVF 177 Score = 24.6 bits (52), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 252 TLLSACAIRGLGDEAEM 268 Score = 21.6 bits (44), Expect(4) = 5e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_008367545.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like, partial [Malus domestica] Length = 389 Score = 58.2 bits (139), Expect(4) = 5e-12 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 158 SILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIELYLV 42 SILTY+++++ C RGGLDWE LLGLF++ RH+GI+ LV Sbjct: 225 SILTYNTVLNACARGGLDWEGLLGLFAEMRHEGIQPDLV 263 Score = 28.5 bits (62), Expect(4) = 5e-12 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV RS F Sbjct: 177 EVFDEMPSQGVVRSVF 192 Score = 25.4 bits (54), Expect(4) = 5e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDEAEM Sbjct: 267 TLLSACAGRGLGDEAEM 283 Score = 23.9 bits (50), Expect(4) = 5e-12 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -3 Query: 228 RGVVSFTALINA---*G*YKVSLDF 163 R V S+TALINA G Y+ SL+F Sbjct: 189 RSVFSYTALINAYGRNGQYETSLEF 213 >ref|XP_013649954.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X1 [Brassica napus] Length = 865 Score = 60.8 bits (146), Expect(4) = 6e-12 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 200 LTLKVSIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 L L ++ IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 196 LELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.6 bits (65), Expect(4) = 6e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV+RS F Sbjct: 162 EVFDEMPSQGVARSVF 177 Score = 23.5 bits (49), Expect(4) = 6e-12 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDE+EM Sbjct: 252 TLLSACAIRGLGDESEM 268 Score = 21.6 bits (44), Expect(4) = 6e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_009106139.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X1 [Brassica rapa] Length = 865 Score = 60.8 bits (146), Expect(4) = 6e-12 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 200 LTLKVSIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 L L ++ IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 196 LELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.6 bits (65), Expect(4) = 6e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV+RS F Sbjct: 162 EVFDEMPSQGVARSVF 177 Score = 23.5 bits (49), Expect(4) = 6e-12 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDE+EM Sbjct: 252 TLLSACAIRGLGDESEM 268 Score = 21.6 bits (44), Expect(4) = 6e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_009106140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X2 [Brassica rapa] Length = 864 Score = 60.8 bits (146), Expect(4) = 6e-12 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 200 LTLKVSIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 L L ++ IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 196 LELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.6 bits (65), Expect(4) = 6e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV+RS F Sbjct: 162 EVFDEMPSQGVARSVF 177 Score = 23.5 bits (49), Expect(4) = 6e-12 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDE+EM Sbjct: 252 TLLSACAIRGLGDESEM 268 Score = 21.6 bits (44), Expect(4) = 6e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_013649956.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X2 [Brassica napus] gi|674887209|emb|CDY45398.1| BnaA07g31780D [Brassica napus] Length = 864 Score = 60.8 bits (146), Expect(4) = 6e-12 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 200 LTLKVSIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 L L ++ IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 196 LELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 244 Score = 29.6 bits (65), Expect(4) = 6e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV+RS F Sbjct: 162 EVFDEMPSQGVARSVF 177 Score = 23.5 bits (49), Expect(4) = 6e-12 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLL A + R LGDE+EM Sbjct: 252 TLLSACAIRGLGDESEM 268 Score = 21.6 bits (44), Expect(4) = 6e-12 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 228 RGVVSFTALINA*G 187 R V S+TALINA G Sbjct: 174 RSVFSYTALINAYG 187 >ref|XP_013589728.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X1 [Brassica oleracea var. oleracea] Length = 911 Score = 60.8 bits (146), Expect(3) = 7e-12 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 200 LTLKVSIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 L L ++ IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 242 LELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 290 Score = 29.6 bits (65), Expect(3) = 7e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV+RS F Sbjct: 208 EVFDEMPSQGVARSVF 223 Score = 25.8 bits (55), Expect(3) = 7e-12 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLLGA + R LGDE+EM Sbjct: 298 TLLGACAIRGLGDESEM 314 >ref|XP_013589729.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X2 [Brassica oleracea var. oleracea] Length = 910 Score = 60.8 bits (146), Expect(3) = 7e-12 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 200 LTLKVSIRFHLISRSILTYDSIIHVCVRGGLDWEALLGLFSQTRHDGIE 54 L L ++ IS SILTY+++I+ C RGGLDWE LLGLF++ RH+GI+ Sbjct: 242 LELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRHEGIQ 290 Score = 29.6 bits (65), Expect(3) = 7e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 262 EVFDEMPSHGVSRSGF 215 EVFDEMPS GV+RS F Sbjct: 208 EVFDEMPSQGVARSVF 223 Score = 25.8 bits (55), Expect(3) = 7e-12 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 54 TLLGAFSSRELGDEAEM 4 TLLGA + R LGDE+EM Sbjct: 298 TLLGACAIRGLGDESEM 314