BLASTX nr result
ID: Papaver31_contig00047226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00047226 (602 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010244033.1| PREDICTED: protein trichome berefringence-li... 74 6e-11 ref|XP_010244031.1| PREDICTED: protein trichome berefringence-li... 74 6e-11 ref|XP_010245826.1| PREDICTED: protein trichome berefringence-li... 73 1e-10 >ref|XP_010244033.1| PREDICTED: protein trichome berefringence-like 7 isoform X2 [Nelumbo nucifera] Length = 376 Score = 73.9 bits (180), Expect = 6e-11 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = -3 Query: 201 KMVATFNRSLSGHYSRKGLSFGSPRSPRVGGHRKTWVSRSFHILVGCSLLITFVLAMGCG 22 KM A NRS+S +R+ LSF S R VG HRK+WVSRSF +L L++F+LA+GC Sbjct: 11 KMTAALNRSMSDRSTRRTLSFSSAR---VGVHRKSWVSRSFCVLTVIGSLVSFLLAIGCA 67 Query: 21 YLYVLPS 1 YLYVLPS Sbjct: 68 YLYVLPS 74 >ref|XP_010244031.1| PREDICTED: protein trichome berefringence-like 7 isoform X1 [Nelumbo nucifera] gi|720087052|ref|XP_010244032.1| PREDICTED: protein trichome berefringence-like 7 isoform X1 [Nelumbo nucifera] Length = 429 Score = 73.9 bits (180), Expect = 6e-11 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = -3 Query: 201 KMVATFNRSLSGHYSRKGLSFGSPRSPRVGGHRKTWVSRSFHILVGCSLLITFVLAMGCG 22 KM A NRS+S +R+ LSF S R VG HRK+WVSRSF +L L++F+LA+GC Sbjct: 11 KMTAALNRSMSDRSTRRTLSFSSAR---VGVHRKSWVSRSFCVLTVIGSLVSFLLAIGCA 67 Query: 21 YLYVLPS 1 YLYVLPS Sbjct: 68 YLYVLPS 74 >ref|XP_010245826.1| PREDICTED: protein trichome berefringence-like 7 [Nelumbo nucifera] Length = 429 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/67 (53%), Positives = 47/67 (70%) Frame = -3 Query: 201 KMVATFNRSLSGHYSRKGLSFGSPRSPRVGGHRKTWVSRSFHILVGCSLLITFVLAMGCG 22 +MV +FNRS+S H + + LSF S + H K+WVSRSFH L+ L++F+LAMGCG Sbjct: 11 EMVTSFNRSMSDHLTLRSLSFNSSGA---ASHCKSWVSRSFHGLLVIGSLVSFLLAMGCG 67 Query: 21 YLYVLPS 1 YLYV PS Sbjct: 68 YLYVFPS 74