BLASTX nr result
ID: Papaver31_contig00046354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00046354 (1401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009770774.1| PREDICTED: uncharacterized protein LOC104221... 61 3e-06 >ref|XP_009770774.1| PREDICTED: uncharacterized protein LOC104221408 [Nicotiana sylvestris] gi|698556508|ref|XP_009770775.1| PREDICTED: uncharacterized protein LOC104221408 [Nicotiana sylvestris] Length = 421 Score = 60.8 bits (146), Expect = 3e-06 Identities = 28/63 (44%), Positives = 39/63 (61%) Frame = -1 Query: 291 WLKVRGIPHRFWSSKLLKTVGDKLGGLIEVATSSLKMAHHNFFRIKVKGDFDMIPAVIVV 112 W+++ GIP WS K+ K +GD+ GG IE + H + RIKVKG FD IP VI + Sbjct: 131 WVRLLGIPLHLWSQKIFKLIGDRCGGWIETEEETSIRNHLKWARIKVKGPFDRIPRVIEM 190 Query: 111 EED 103 E++ Sbjct: 191 EKN 193