BLASTX nr result
ID: Papaver31_contig00046304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00046304 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001047932.1| Os02g0717400 [Oryza sativa Japonica Group] g... 58 2e-06 ref|XP_008461782.1| PREDICTED: clustered mitochondria protein is... 58 2e-06 ref|XP_008461781.1| PREDICTED: clustered mitochondria protein is... 58 2e-06 gb|EEE57688.1| hypothetical protein OsJ_08153 [Oryza sativa Japo... 58 2e-06 gb|EEC73894.1| hypothetical protein OsI_08701 [Oryza sativa Indi... 58 2e-06 ref|XP_011651791.1| PREDICTED: clustered mitochondria protein [C... 58 2e-06 ref|XP_010235889.1| PREDICTED: clustered mitochondria protein is... 57 5e-06 ref|XP_009395905.1| PREDICTED: clustered mitochondria protein-li... 57 5e-06 ref|XP_009395904.1| PREDICTED: clustered mitochondria protein-li... 57 5e-06 ref|XP_009395902.1| PREDICTED: clustered mitochondria protein-li... 57 5e-06 ref|XP_006647798.1| PREDICTED: clustered mitochondria protein-li... 57 5e-06 ref|XP_003570239.1| PREDICTED: clustered mitochondria protein is... 57 5e-06 ref|XP_010659324.1| PREDICTED: clustered mitochondria protein [V... 57 7e-06 ref|XP_010102634.1| Protein KIAA0664-like protein [Morus notabil... 56 9e-06 ref|XP_008795740.1| PREDICTED: clustered mitochondria protein-li... 56 9e-06 ref|XP_008795739.1| PREDICTED: clustered mitochondria protein-li... 56 9e-06 >ref|NP_001047932.1| Os02g0717400 [Oryza sativa Japonica Group] gi|42408048|dbj|BAD09184.1| eukaryotic translation initiation factor 3 subunit (eIF-3)-like [Oryza sativa Japonica Group] gi|45735861|dbj|BAD12895.1| eukaryotic translation initiation factor 3 subunit (eIF-3)-like [Oryza sativa Japonica Group] gi|113537463|dbj|BAF09846.1| Os02g0717400 [Oryza sativa Japonica Group] gi|937905567|dbj|BAS80621.1| Os02g0717400 [Oryza sativa Japonica Group] Length = 1426 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA+RKYDL+AAAPFQ SDILNLQPV+K Sbjct: 978 KVGITIASRKYDLDAAAPFQPSDILNLQPVVK 1009 >ref|XP_008461782.1| PREDICTED: clustered mitochondria protein isoform X2 [Cucumis melo] gi|659123678|ref|XP_008461783.1| PREDICTED: clustered mitochondria protein isoform X2 [Cucumis melo] gi|659123680|ref|XP_008461784.1| PREDICTED: clustered mitochondria protein isoform X2 [Cucumis melo] Length = 1420 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGIT+A RKYDL +AAPFQTSDILNLQPVIK Sbjct: 982 KVGITVAARKYDLNSAAPFQTSDILNLQPVIK 1013 >ref|XP_008461781.1| PREDICTED: clustered mitochondria protein isoform X1 [Cucumis melo] Length = 1424 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGIT+A RKYDL +AAPFQTSDILNLQPVIK Sbjct: 986 KVGITVAARKYDLNSAAPFQTSDILNLQPVIK 1017 >gb|EEE57688.1| hypothetical protein OsJ_08153 [Oryza sativa Japonica Group] Length = 1447 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA+RKYDL+AAAPFQ SDILNLQPV+K Sbjct: 966 KVGITIASRKYDLDAAAPFQPSDILNLQPVVK 997 >gb|EEC73894.1| hypothetical protein OsI_08701 [Oryza sativa Indica Group] Length = 1426 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA+RKYDL+AAAPFQ SDILNLQPV+K Sbjct: 978 KVGITIASRKYDLDAAAPFQPSDILNLQPVVK 1009 >ref|XP_011651791.1| PREDICTED: clustered mitochondria protein [Cucumis sativus] gi|778682837|ref|XP_011651792.1| PREDICTED: clustered mitochondria protein [Cucumis sativus] gi|700203480|gb|KGN58613.1| hypothetical protein Csa_3G698540 [Cucumis sativus] Length = 1410 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGIT+A RKYDL +AAPFQTSDILNLQPVIK Sbjct: 972 KVGITVAARKYDLSSAAPFQTSDILNLQPVIK 1003 >ref|XP_010235889.1| PREDICTED: clustered mitochondria protein isoform X2 [Brachypodium distachyon] gi|944065443|gb|KQK01034.1| hypothetical protein BRADI_3g53420 [Brachypodium distachyon] Length = 1382 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RKYDL AAAPFQ SDILNLQPV+K Sbjct: 949 KVGITIAARKYDLNAAAPFQPSDILNLQPVVK 980 >ref|XP_009395905.1| PREDICTED: clustered mitochondria protein-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 1441 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RKYDL+A+ PFQTSDILNLQPV+K Sbjct: 984 KVGITIAARKYDLDASLPFQTSDILNLQPVVK 1015 >ref|XP_009395904.1| PREDICTED: clustered mitochondria protein-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 1463 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RKYDL+A+ PFQTSDILNLQPV+K Sbjct: 982 KVGITIAARKYDLDASLPFQTSDILNLQPVVK 1013 >ref|XP_009395902.1| PREDICTED: clustered mitochondria protein-like isoform X1 [Musa acuminata subsp. malaccensis] gi|695017917|ref|XP_009395903.1| PREDICTED: clustered mitochondria protein-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 1465 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RKYDL+A+ PFQTSDILNLQPV+K Sbjct: 984 KVGITIAARKYDLDASLPFQTSDILNLQPVVK 1015 >ref|XP_006647798.1| PREDICTED: clustered mitochondria protein-like [Oryza brachyantha] Length = 1425 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA+RKYDL++AAPFQ SDILNLQPV+K Sbjct: 983 KVGITIASRKYDLDSAAPFQPSDILNLQPVVK 1014 >ref|XP_003570239.1| PREDICTED: clustered mitochondria protein isoform X1 [Brachypodium distachyon] gi|944065442|gb|KQK01033.1| hypothetical protein BRADI_3g53420 [Brachypodium distachyon] Length = 1383 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RKYDL AAAPFQ SDILNLQPV+K Sbjct: 950 KVGITIAARKYDLNAAAPFQPSDILNLQPVVK 981 >ref|XP_010659324.1| PREDICTED: clustered mitochondria protein [Vitis vinifera] gi|297736213|emb|CBI24851.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RKYDL++A+PFQT+DILNLQPV+K Sbjct: 986 KVGITIAARKYDLDSASPFQTADILNLQPVVK 1017 >ref|XP_010102634.1| Protein KIAA0664-like protein [Morus notabilis] gi|587905644|gb|EXB93784.1| Protein KIAA0664-like protein [Morus notabilis] Length = 1398 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA R+YDL +AAPFQT+DILNLQPVIK Sbjct: 955 KVGITIAARRYDLNSAAPFQTTDILNLQPVIK 986 >ref|XP_008795740.1| PREDICTED: clustered mitochondria protein-like isoform X2 [Phoenix dactylifera] Length = 1302 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RK+DL+++APFQTSDILNLQPV+K Sbjct: 840 KVGITIAARKFDLDSSAPFQTSDILNLQPVVK 871 >ref|XP_008795739.1| PREDICTED: clustered mitochondria protein-like isoform X1 [Phoenix dactylifera] Length = 1415 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 111 QVGITIATRKYDLEAAAPFQTSDILNLQPVIK 16 +VGITIA RK+DL+++APFQTSDILNLQPV+K Sbjct: 953 KVGITIAARKFDLDSSAPFQTSDILNLQPVVK 984