BLASTX nr result
ID: Papaver31_contig00046113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00046113 (579 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012832893.1| PREDICTED: protein NETWORKED 3C [Erythranthe... 57 9e-06 >ref|XP_012832893.1| PREDICTED: protein NETWORKED 3C [Erythranthe guttatus] gi|604348501|gb|EYU46656.1| hypothetical protein MIMGU_mgv1a011980mg [Erythranthe guttata] Length = 265 Score = 56.6 bits (135), Expect = 9e-06 Identities = 27/59 (45%), Positives = 40/59 (67%) Frame = -1 Query: 363 VIRQLSLSMEILRDDLNRTKSKVTESALKKKNPFEFNTFKELFSGKLFNGLSKSKVSTI 187 VIRQLSL+M++LR++ + + ++A KK+N E+N KE F GKLFNG KS + + Sbjct: 205 VIRQLSLAMDLLREENLNLRQNLAKNAPKKENQIEYNKLKEGFFGKLFNGFGKSPANLV 263