BLASTX nr result
ID: Papaver31_contig00045373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00045373 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011018631.1| PREDICTED: two-component response regulator-... 70 6e-10 ref|XP_011018630.1| PREDICTED: two-component response regulator-... 70 6e-10 ref|XP_011018627.1| PREDICTED: two-component response regulator-... 70 6e-10 ref|XP_006368450.1| hypothetical protein POPTR_0001s02910g [Popu... 70 6e-10 ref|XP_006368449.1| hypothetical protein POPTR_0001s02910g [Popu... 70 6e-10 ref|XP_006368446.1| hypothetical protein POPTR_0001s02910g [Popu... 70 6e-10 gb|KNA21914.1| hypothetical protein SOVF_039000 isoform B [Spina... 70 8e-10 gb|KNA21913.1| hypothetical protein SOVF_039000 isoform A [Spina... 70 8e-10 gb|KHG22258.1| Two-component response regulator-like APRR2 [Goss... 70 8e-10 ref|XP_010275322.1| PREDICTED: two-component response regulator-... 70 8e-10 ref|XP_010275321.1| PREDICTED: two-component response regulator-... 70 8e-10 ref|XP_010275320.1| PREDICTED: two-component response regulator-... 70 8e-10 ref|XP_010275314.1| PREDICTED: two-component response regulator-... 70 8e-10 ref|XP_010677299.1| PREDICTED: two-component response regulator-... 69 1e-09 ref|XP_010677297.1| PREDICTED: two-component response regulator-... 69 1e-09 ref|XP_002279150.1| PREDICTED: two-component response regulator-... 69 1e-09 emb|CAN71929.1| hypothetical protein VITISV_001044 [Vitis vinifera] 69 1e-09 ref|XP_013457531.1| two-component response regulator-APRR2-like ... 69 2e-09 ref|XP_013457529.1| two-component response regulator-APRR2-like ... 69 2e-09 ref|XP_013457527.1| two-component response regulator-APRR2-like ... 69 2e-09 >ref|XP_011018631.1| PREDICTED: two-component response regulator-like APRR2 isoform X3 [Populus euphratica] Length = 531 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCTT DL WKDFPKGLR+LLLDED S AEIK KLE MDY Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDY 42 >ref|XP_011018630.1| PREDICTED: two-component response regulator-like APRR2 isoform X2 [Populus euphratica] Length = 540 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCTT DL WKDFPKGLR+LLLDED S AEIK KLE MDY Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDY 42 >ref|XP_011018627.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Populus euphratica] gi|743809955|ref|XP_011018628.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Populus euphratica] gi|743809959|ref|XP_011018629.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Populus euphratica] Length = 557 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCTT DL WKDFPKGLR+LLLDED S AEIK KLE MDY Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDY 42 >ref|XP_006368450.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346364|gb|ERP65019.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 537 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCTT DL WKDFPKGLR+LLLDED S AEIK KLE MDY Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDY 42 >ref|XP_006368449.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346363|gb|ERP65018.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 500 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCTT DL WKDFPKGLR+LLLDED S AEIK KLE MDY Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDY 42 >ref|XP_006368446.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|566146887|ref|XP_006368447.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|566146889|ref|XP_006368448.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346360|gb|ERP65015.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346361|gb|ERP65016.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346362|gb|ERP65017.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 463 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCTT DL WKDFPKGLR+LLLDED S AEIK KLE MDY Sbjct: 1 MVCTTNDLSAWKDFPKGLRVLLLDEDSMSAAEIKSKLEAMDY 42 >gb|KNA21914.1| hypothetical protein SOVF_039000 isoform B [Spinacia oleracea] Length = 571 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT DLLEWKDFPKGLRILLL+ED S AEIK KLE+M++ Sbjct: 1 MVCTANDLLEWKDFPKGLRILLLEEDTNSAAEIKSKLEEMEF 42 >gb|KNA21913.1| hypothetical protein SOVF_039000 isoform A [Spinacia oleracea] Length = 615 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT DLLEWKDFPKGLRILLL+ED S AEIK KLE+M++ Sbjct: 45 MVCTANDLLEWKDFPKGLRILLLEEDTNSAAEIKSKLEEMEF 86 >gb|KHG22258.1| Two-component response regulator-like APRR2 [Gossypium arboreum] Length = 561 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 M+CTT DL EWKDFPKGL++LLLDED S AE+K KLE MDY Sbjct: 1 MICTTNDLSEWKDFPKGLKVLLLDEDSNSAAELKSKLEAMDY 42 >ref|XP_010275322.1| PREDICTED: two-component response regulator-like APRR2 isoform X4 [Nelumbo nucifera] Length = 504 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT +DLL WKDFPKGLR+LLLDED S EIK KLE+MDY Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010275321.1| PREDICTED: two-component response regulator-like APRR2 isoform X3 [Nelumbo nucifera] Length = 558 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT +DLL WKDFPKGLR+LLLDED S EIK KLE+MDY Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010275320.1| PREDICTED: two-component response regulator-like APRR2 isoform X2 [Nelumbo nucifera] Length = 559 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT +DLL WKDFPKGLR+LLLDED S EIK KLE+MDY Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010275314.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061877|ref|XP_010275315.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061880|ref|XP_010275317.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061884|ref|XP_010275318.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061887|ref|XP_010275319.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] Length = 561 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT +DLL WKDFPKGLR+LLLDED S EIK KLE+MDY Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010677299.1| PREDICTED: two-component response regulator-like APRR2 isoform X2 [Beta vulgaris subsp. vulgaris] gi|870860372|gb|KMT11725.1| hypothetical protein BVRB_5g106620 isoform A [Beta vulgaris subsp. vulgaris] Length = 546 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT DLLEWK+FPKGL+ILLLDED S AEIK KLE+M+Y Sbjct: 1 MVCTANDLLEWKNFPKGLKILLLDEDTDSAAEIKSKLEEMEY 42 >ref|XP_010677297.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Beta vulgaris subsp. vulgaris] gi|731332614|ref|XP_010677298.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Beta vulgaris subsp. vulgaris] gi|870860373|gb|KMT11726.1| hypothetical protein BVRB_5g106620 isoform B [Beta vulgaris subsp. vulgaris] Length = 547 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT DLLEWK+FPKGL+ILLLDED S AEIK KLE+M+Y Sbjct: 1 MVCTANDLLEWKNFPKGLKILLLDEDTDSAAEIKSKLEEMEY 42 >ref|XP_002279150.1| PREDICTED: two-component response regulator-like APRR2 [Vitis vinifera] gi|297742160|emb|CBI33947.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT DL EWKDFPKGLR+LLLD+D S AEI+ KLE+MDY Sbjct: 1 MVCTANDLQEWKDFPKGLRVLLLDDDTTSAAEIRSKLEEMDY 42 >emb|CAN71929.1| hypothetical protein VITISV_001044 [Vitis vinifera] Length = 563 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 128 MVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 MVCT DL EWKDFPKGLR+LLLD+D S AEI+ KLE+MDY Sbjct: 1 MVCTANDLQEWKDFPKGLRVLLLDDDTTSAAEIRSKLEEMDY 42 >ref|XP_013457531.1| two-component response regulator-APRR2-like protein [Medicago truncatula] gi|657389939|gb|KEH31562.1| two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 580 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = -2 Query: 164 LRKDDKAKPAADMVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 LRKD AKPA MVCT DL EWKDFPKGL++LLL+ D S +EI++KLE MDY Sbjct: 13 LRKD--AKPA--MVCTANDLQEWKDFPKGLKVLLLEGDNTSVSEIRVKLEAMDY 62 >ref|XP_013457529.1| two-component response regulator-APRR2-like protein [Medicago truncatula] gi|657389937|gb|KEH31560.1| two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 575 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = -2 Query: 164 LRKDDKAKPAADMVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 LRKD AKPA MVCT DL EWKDFPKGL++LLL+ D S +EI++KLE MDY Sbjct: 13 LRKD--AKPA--MVCTANDLQEWKDFPKGLKVLLLEGDNTSVSEIRVKLEAMDY 62 >ref|XP_013457527.1| two-component response regulator-APRR2-like protein [Medicago truncatula] gi|657389935|gb|KEH31558.1| two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 594 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = -2 Query: 164 LRKDDKAKPAADMVCTTEDLLEWKDFPKGLRILLLDEDIYSTAEIKLKLEQMDY 3 LRKD AKPA MVCT DL EWKDFPKGL++LLL+ D S +EI++KLE MDY Sbjct: 32 LRKD--AKPA--MVCTANDLQEWKDFPKGLKVLLLEGDNTSVSEIRVKLEAMDY 81