BLASTX nr result
ID: Papaver31_contig00045345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00045345 (599 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB70984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 62 3e-07 gb|AFS28680.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate... 61 4e-07 ref|XP_011092767.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 61 5e-07 ref|XP_011088335.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 61 5e-07 ref|XP_010690939.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 61 5e-07 gb|AIM62159.1| 4-hydroxy-3-methylbut-2-enyl-4-diphosphate reduct... 61 5e-07 emb|CBI32545.3| unnamed protein product [Vitis vinifera] 61 5e-07 ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 61 5e-07 gb|ABM89226.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 61 5e-07 ref|XP_009373542.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 60 7e-07 ref|XP_008362078.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 60 7e-07 gb|EYU37754.1| hypothetical protein MIMGU_mgv1a005937mg [Erythra... 60 7e-07 ref|XP_012837005.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 60 7e-07 ref|XP_012837007.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 60 7e-07 gb|AGJ03149.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 60 7e-07 gb|AFQ95412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 60 7e-07 gb|AEZ55669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 60 7e-07 gb|AAQ54537.1| LYTB-like protein [Malus domestica] 60 7e-07 gb|KRH29514.1| hypothetical protein GLYMA_11G120900 [Glycine max] 60 9e-07 gb|KRH24511.1| hypothetical protein GLYMA_12G046000 [Glycine max] 60 9e-07 >gb|AFB70984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, partial [Mitragyna speciosa] Length = 96 Score = 61.6 bits (148), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 LHGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 46 LHGELVEKENWLPEGPITIGVTSGASTPDK 75 >gb|AFS28680.1| putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, partial [Olea europaea] Length = 371 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGPVTIGVTSGAST D+ Sbjct: 337 MHGELVEKENWLPEGPVTIGVTSGASTPDK 366 >ref|XP_011092767.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Sesamum indicum] Length = 460 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 LHGELVEKENWLPEGP+T+G+TSGAST D+ Sbjct: 410 LHGELVEKENWLPEGPITVGITSGASTPDK 439 >ref|XP_011088335.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Sesamum indicum] Length = 462 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGPVTIG+TSGAST D+ Sbjct: 412 MHGELVEKENWLPEGPVTIGITSGASTPDK 441 >ref|XP_010690939.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870848204|gb|KMT00493.1| hypothetical protein BVRB_9g217920 [Beta vulgaris subsp. vulgaris] Length = 466 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 412 MHGELVEKENWLPEGPITIGVTSGASTPDK 441 >gb|AIM62159.1| 4-hydroxy-3-methylbut-2-enyl-4-diphosphate reductase [Tripterygium wilfordii] Length = 461 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 411 MHGELVEKENWLPEGPITIGVTSGASTPDK 440 >emb|CBI32545.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 330 MHGELVEKENWLPEGPITIGVTSGASTPDK 359 >ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Vitis vinifera] Length = 465 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 415 MHGELVEKENWLPEGPITIGVTSGASTPDK 444 >gb|ABM89226.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Picrorhiza kurrooa] Length = 462 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 412 MHGELVEKENWLPEGPITIGVTSGASTPDK 441 >ref|XP_009373542.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like, partial [Pyrus x bretschneideri] Length = 382 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 429 HGELVEKENWLPEGPVTIGVTSGASTQDE 343 HGELVEKENWLPEGPVTIGVTSGAST D+ Sbjct: 333 HGELVEKENWLPEGPVTIGVTSGASTPDK 361 >ref|XP_008362078.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Malus domestica] Length = 460 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 429 HGELVEKENWLPEGPVTIGVTSGASTQDE 343 HGELVEKENWLPEGPVTIGVTSGAST D+ Sbjct: 411 HGELVEKENWLPEGPVTIGVTSGASTPDK 439 >gb|EYU37754.1| hypothetical protein MIMGU_mgv1a005937mg [Erythranthe guttata] Length = 464 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIG+TSGAST D+ Sbjct: 414 MHGELVEKENWLPEGPITIGITSGASTPDK 443 >ref|XP_012837005.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Erythranthe guttatus] gi|604333402|gb|EYU37753.1| hypothetical protein MIMGU_mgv1a005937mg [Erythranthe guttata] Length = 464 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIG+TSGAST D+ Sbjct: 414 MHGELVEKENWLPEGPITIGITSGASTPDK 443 >ref|XP_012837007.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Erythranthe guttatus] gi|604333400|gb|EYU37751.1| hypothetical protein MIMGU_mgv1a026562mg [Erythranthe guttata] Length = 455 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENWLPEGP+TIG+TSGAST D+ Sbjct: 405 MHGELVEKENWLPEGPITIGITSGASTPDK 434 >gb|AGJ03149.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Salvia miltiorrhiza f. alba] Length = 463 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENW+PEGPVTIGVTSGAST D+ Sbjct: 413 MHGELVEKENWMPEGPVTIGVTSGASTPDK 442 >gb|AFQ95412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salvia miltiorrhiza] Length = 463 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENW+PEGPVTIGVTSGAST D+ Sbjct: 413 MHGELVEKENWMPEGPVTIGVTSGASTPDK 442 >gb|AEZ55669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 [Salvia miltiorrhiza] Length = 463 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LHGELVEKENWLPEGPVTIGVTSGASTQDE 343 +HGELVEKENW+PEGPVTIGVTSGAST D+ Sbjct: 413 MHGELVEKENWMPEGPVTIGVTSGASTPDK 442 >gb|AAQ54537.1| LYTB-like protein [Malus domestica] Length = 71 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 429 HGELVEKENWLPEGPVTIGVTSGASTQDE 343 HGELVEKENWLPEGPVTIGVTSGAST D+ Sbjct: 22 HGELVEKENWLPEGPVTIGVTSGASTPDK 50 >gb|KRH29514.1| hypothetical protein GLYMA_11G120900 [Glycine max] Length = 445 Score = 60.1 bits (144), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 429 HGELVEKENWLPEGPVTIGVTSGASTQDE 343 HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 413 HGELVEKENWLPEGPITIGVTSGASTPDK 441 >gb|KRH24511.1| hypothetical protein GLYMA_12G046000 [Glycine max] Length = 461 Score = 60.1 bits (144), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 429 HGELVEKENWLPEGPVTIGVTSGASTQDE 343 HGELVEKENWLPEGP+TIGVTSGAST D+ Sbjct: 412 HGELVEKENWLPEGPITIGVTSGASTPDK 440