BLASTX nr result
ID: Papaver31_contig00044951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00044951 (1069 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088745.1| PREDICTED: B3 domain-containing protein At5g... 59 5e-06 gb|KDO42473.1| hypothetical protein CISIN_1g036935mg, partial [C... 59 7e-06 ref|XP_010269238.1| PREDICTED: B3 domain-containing protein Os01... 59 9e-06 ref|XP_010269230.1| PREDICTED: B3 domain-containing protein Os01... 59 9e-06 >ref|XP_011088745.1| PREDICTED: B3 domain-containing protein At5g42700-like [Sesamum indicum] Length = 275 Score = 59.3 bits (142), Expect = 5e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 200 YLPWRLGLSGGWKGFSIAYNLAKGDALVFHLVDVAKFKMII 322 YLP R GLS GW+GFSI++NL +GD LVFHLV V K K+ I Sbjct: 131 YLPERRGLSAGWRGFSISHNLEEGDILVFHLVGVCKMKVYI 171 >gb|KDO42473.1| hypothetical protein CISIN_1g036935mg, partial [Citrus sinensis] Length = 399 Score = 58.9 bits (141), Expect = 7e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 200 YLPWRLGLSGGWKGFSIAYNLAKGDALVFHLVDVAKFKMII 322 YL ++GLS GW+GFSIA+ L +GDALVFHLV ++KFK+ I Sbjct: 86 YLVEKIGLSAGWRGFSIAHKLVEGDALVFHLVTLSKFKVYI 126 >ref|XP_010269238.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X2 [Nelumbo nucifera] Length = 453 Score = 58.5 bits (140), Expect = 9e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 200 YLPWRLGLSGGWKGFSIAYNLAKGDALVFHLVDVAKFKMII 322 YL R+GLSGGW+GFSIA+ L +GD L+F LV V KFK+ I Sbjct: 143 YLAQRVGLSGGWRGFSIAHKLVEGDVLIFQLVTVTKFKVYI 183 >ref|XP_010269230.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X1 [Nelumbo nucifera] Length = 488 Score = 58.5 bits (140), Expect = 9e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 200 YLPWRLGLSGGWKGFSIAYNLAKGDALVFHLVDVAKFKMII 322 YL R+GLSGGW+GFSIA+ L +GD L+F LV V KFK+ I Sbjct: 178 YLAQRVGLSGGWRGFSIAHKLVEGDVLIFQLVTVTKFKVYI 218