BLASTX nr result
ID: Papaver31_contig00044853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00044853 (737 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 46 1e-07 gb|KQK20681.1| hypothetical protein BRADI_1g63372 [Brachypodium ... 43 2e-07 ref|XP_002886871.1| predicted protein [Arabidopsis lyrata subsp.... 52 6e-06 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +3 Query: 99 VSNSKPNMKLWFHSAPLWK 155 VSNSKPNMKLWFHSAPLW+ Sbjct: 39 VSNSKPNMKLWFHSAPLWR 57 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = +2 Query: 14 ERVAGIEPASLAWKARGY 67 +RVAGIEPASLAWKA+GY Sbjct: 12 KRVAGIEPASLAWKAKGY 29 >gb|KQK20681.1| hypothetical protein BRADI_1g63372 [Brachypodium distachyon] Length = 59 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 11 MERVAGIEPASLAWKARGY 67 MERVAGIEPASLAWKARGY Sbjct: 1 MERVAGIEPASLAWKARGY 19 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +3 Query: 90 LFDVSNSKPNMKLWFHSAPLW 152 +++VSNSKPNMK FHSAPLW Sbjct: 26 IYNVSNSKPNMKFSFHSAPLW 46 >ref|XP_002886871.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332712|gb|EFH63130.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 57 Score = 51.6 bits (122), Expect(2) = 6e-06 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = +1 Query: 538 KNYASQFHNPIFHFELTLGYKSRECIFFLKSFIER*RIKSF 660 KNY S+FHNP GYK RE I FL+SFIER R KSF Sbjct: 17 KNYVSEFHNPNLQLIRVFGYKLRESIIFLESFIERERTKSF 57 Score = 26.6 bits (57), Expect(2) = 6e-06 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 488 MDPLFILIQLEVLIQLK 538 MDPL ILI+L ++IQ K Sbjct: 1 MDPLVILIELSIVIQFK 17