BLASTX nr result
ID: Papaver31_contig00044811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00044811 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010094493.1| Squamosa promoter-binding-like protein 14 [M... 51 1e-08 >ref|XP_010094493.1| Squamosa promoter-binding-like protein 14 [Morus notabilis] gi|587866809|gb|EXB56247.1| Squamosa promoter-binding-like protein 14 [Morus notabilis] Length = 1042 Score = 50.8 bits (120), Expect(2) = 1e-08 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -3 Query: 268 K*CYKCSIESMGYYNCIPGYQVLLHWPYVHPILAVAFVCVCVSI 137 K C KC++ + +Y +PG Q LL PYVH +LA+A VCVCV + Sbjct: 975 KSCAKCAVAATRHYKRVPGAQGLLQRPYVHSMLAIAAVCVCVCL 1018 Score = 35.0 bits (79), Expect(2) = 1e-08 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 429 NSWNSFLDTRGMSPFSYALL 370 NSWNS LD G SP++YAL+ Sbjct: 917 NSWNSLLDANGQSPYAYALM 936