BLASTX nr result
ID: Papaver31_contig00044569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00044569 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275395.1| PREDICTED: argininosuccinate synthase, chlor... 71 4e-10 >ref|XP_010275395.1| PREDICTED: argininosuccinate synthase, chloroplastic [Nelumbo nucifera] gi|719971692|ref|XP_010275404.1| PREDICTED: argininosuccinate synthase, chloroplastic [Nelumbo nucifera] Length = 492 Score = 70.9 bits (172), Expect = 4e-10 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 6/89 (6%) Frame = -1 Query: 252 MAQLRAISSSSSTNFVFNGANKSEPALVRNQICYSNKFSSV------SSGFNGNALVHNN 91 MAQL+A+ S S+NFVF+ + +S+ R+++C K SS SSG +G+ALVH+ Sbjct: 1 MAQLQAVLSCPSSNFVFHASKRSDS--FRDKLCCLGKSSSFQELGVRSSGLHGSALVHHR 58 Query: 90 PNLTRASNNKVIQAVAASDKGIDVSVSPK 4 NL +AS + IQAV +S+K DVS SPK Sbjct: 59 GNLAQASTGRAIQAVLSSEKETDVSTSPK 87