BLASTX nr result
ID: Papaver31_contig00043362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00043362 (501 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11966.1| unnamed protein product [Coffea canephora] 57 4e-06 >emb|CDP11966.1| unnamed protein product [Coffea canephora] Length = 553 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 213 QAIDPRTCVVLFKMPNRAIFDEINSCISTGKEVCYTHNELPD 88 QAIDPRT +VLFKM NR IF++IN CISTGKE H PD Sbjct: 137 QAIDPRTRMVLFKMLNRGIFNDINGCISTGKEANVYHATKPD 178