BLASTX nr result
ID: Papaver31_contig00043210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00043210 (781 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112162.1| hypothetical protein L484_019901 [Morus nota... 58 8e-06 >ref|XP_010112162.1| hypothetical protein L484_019901 [Morus notabilis] gi|587946448|gb|EXC32787.1| hypothetical protein L484_019901 [Morus notabilis] Length = 113 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 350 RVRVSYDPSSYLKNFDQGCPLNEPDCYSRSFSARYAHPSRI 228 R++ SYDP++Y KNFDQG EPD SRSFSAR+A PSRI Sbjct: 64 RLQPSYDPTTYSKNFDQGMGWEEPDYLSRSFSARFADPSRI 104