BLASTX nr result
ID: Papaver31_contig00042247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00042247 (547 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007156601.1| hypothetical protein PHAVU_002G002500g [Phas... 74 4e-11 gb|KJB22275.1| hypothetical protein B456_004G038500 [Gossypium r... 72 2e-10 gb|KQL25879.1| hypothetical protein SETIT_030672mg [Setaria ital... 70 5e-10 ref|XP_010941020.1| PREDICTED: casein kinase II subunit beta-lik... 70 5e-10 tpg|DAA62803.1| TPA: hypothetical protein ZEAMMB73_706069 [Zea m... 70 5e-10 gb|KJB49279.1| hypothetical protein B456_008G110700 [Gossypium r... 70 6e-10 gb|KDO85441.1| hypothetical protein CISIN_1g023046mg [Citrus sin... 70 6e-10 ref|XP_008343813.1| PREDICTED: putative casein kinase II subunit... 70 8e-10 ref|XP_013453449.1| casein kinase II beta chain 2 [Medicago trun... 70 8e-10 ref|XP_013453451.1| casein kinase II beta chain 2 [Medicago trun... 70 8e-10 ref|NP_001032026.1| casein kinase 2 subunit beta [Arabidopsis th... 69 1e-09 ref|NP_974896.1| casein kinase 2 subunit beta [Arabidopsis thali... 69 1e-09 ref|XP_006440148.1| hypothetical protein CICLE_v10021529mg [Citr... 69 1e-09 gb|KOM44866.1| hypothetical protein LR48_Vigan06g017200 [Vigna a... 69 2e-09 gb|KJB24852.1| hypothetical protein B456_004G167300 [Gossypium r... 68 2e-09 gb|KRH04255.1| hypothetical protein GLYMA_17G149500 [Glycine max] 68 3e-09 gb|KHG26497.1| Casein kinase II subunit beta -like protein [Goss... 67 4e-09 gb|KHG10632.1| Casein kinase II subunit beta -like protein [Goss... 67 4e-09 ref|XP_009796642.1| PREDICTED: casein kinase II subunit beta-lik... 67 4e-09 gb|KNA11361.1| hypothetical protein SOVF_135920 [Spinacia oleracea] 67 5e-09 >ref|XP_007156601.1| hypothetical protein PHAVU_002G002500g [Phaseolus vulgaris] gi|561030016|gb|ESW28595.1| hypothetical protein PHAVU_002G002500g [Phaseolus vulgaris] Length = 273 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFYLV 440 SDIPRSSTVKIYCP+CEDIYYPRSKYQGSIL +Y++ Sbjct: 215 SDIPRSSTVKIYCPRCEDIYYPRSKYQGSILIYYII 250 >gb|KJB22275.1| hypothetical protein B456_004G038500 [Gossypium raimondii] Length = 273 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILT 452 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILT Sbjct: 216 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILT 247 >gb|KQL25879.1| hypothetical protein SETIT_030672mg [Setaria italica] Length = 296 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFYLVN*L-SGCI 419 SDI RSSTVKIYCPKCEDIYYPRSKYQGSILT L++ L + C+ Sbjct: 201 SDIHRSSTVKIYCPKCEDIYYPRSKYQGSILTILLLDYLINACV 244 >ref|XP_010941020.1| PREDICTED: casein kinase II subunit beta-like isoform X3 [Elaeis guineensis] Length = 262 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFYL 443 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL+ + Sbjct: 216 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILSMLM 250 >tpg|DAA62803.1| TPA: hypothetical protein ZEAMMB73_706069 [Zea mays] Length = 252 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFYLVN*LSGCIHQ 413 SDI RSSTVKIYCPKCEDIYYPRSKYQGSILT L + L+ + Q Sbjct: 203 SDIHRSSTVKIYCPKCEDIYYPRSKYQGSILTILLSDCLNAYMFQ 247 >gb|KJB49279.1| hypothetical protein B456_008G110700 [Gossypium raimondii] Length = 255 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILT 452 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL+ Sbjct: 208 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILS 239 >gb|KDO85441.1| hypothetical protein CISIN_1g023046mg [Citrus sinensis] Length = 254 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFYLVN*LSGCI 419 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL + GCI Sbjct: 218 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILK------IVGCI 254 >ref|XP_008343813.1| PREDICTED: putative casein kinase II subunit beta-4 isoform X1 [Malus domestica] Length = 321 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL Sbjct: 234 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 264 >ref|XP_013453449.1| casein kinase II beta chain 2 [Medicago truncatula] gi|657383953|gb|KEH27482.1| casein kinase II beta chain 2 [Medicago truncatula] Length = 290 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFY 446 SDIPRSSTVKIYCP+CEDIYYPRSKYQGSIL Y Sbjct: 211 SDIPRSSTVKIYCPRCEDIYYPRSKYQGSILIQY 244 >ref|XP_013453451.1| casein kinase II beta chain 2 [Medicago truncatula] gi|657383952|gb|KEH27481.1| casein kinase II beta chain 2 [Medicago truncatula] Length = 295 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFY 446 SDIPRSSTVKIYCP+CEDIYYPRSKYQGSIL Y Sbjct: 216 SDIPRSSTVKIYCPRCEDIYYPRSKYQGSILIQY 249 >ref|NP_001032026.1| casein kinase 2 subunit beta [Arabidopsis thaliana] gi|332008085|gb|AED95468.1| casein kinase 2 subunit beta [Arabidopsis thaliana] Length = 253 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SD+PRSSTVKIYCPKCEDIYYPRSKYQGSIL Sbjct: 214 SDLPRSSTVKIYCPKCEDIYYPRSKYQGSIL 244 >ref|NP_974896.1| casein kinase 2 subunit beta [Arabidopsis thaliana] gi|332008084|gb|AED95467.1| casein kinase 2 subunit beta [Arabidopsis thaliana] Length = 256 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SD+PRSSTVKIYCPKCEDIYYPRSKYQGSIL Sbjct: 217 SDLPRSSTVKIYCPKCEDIYYPRSKYQGSIL 247 >ref|XP_006440148.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] gi|557542410|gb|ESR53388.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] Length = 252 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL-TFYL 443 SDIPRSSTVKIYCP+CEDIYYPRSKYQGSIL F+L Sbjct: 214 SDIPRSSTVKIYCPRCEDIYYPRSKYQGSILQNFFL 249 >gb|KOM44866.1| hypothetical protein LR48_Vigan06g017200 [Vigna angularis] Length = 257 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SDIPRSSTVKIYCP+CEDIYYPRSKYQGSIL Sbjct: 216 SDIPRSSTVKIYCPRCEDIYYPRSKYQGSIL 246 >gb|KJB24852.1| hypothetical protein B456_004G167300 [Gossypium raimondii] Length = 249 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SDIPR+STVKIYCPKCED+YYPRSKYQGSIL Sbjct: 206 SDIPRASTVKIYCPKCEDVYYPRSKYQGSIL 236 >gb|KRH04255.1| hypothetical protein GLYMA_17G149500 [Glycine max] Length = 263 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SDIPRSSTVKIYCP+CED+YYPRSKYQGSIL Sbjct: 191 SDIPRSSTVKIYCPRCEDLYYPRSKYQGSIL 221 >gb|KHG26497.1| Casein kinase II subunit beta -like protein [Gossypium arboreum] Length = 150 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SDIPR+STVKIYCP+CEDIYYPRSKYQGSIL Sbjct: 63 SDIPRASTVKIYCPRCEDIYYPRSKYQGSIL 93 >gb|KHG10632.1| Casein kinase II subunit beta -like protein [Gossypium arboreum] Length = 266 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSIL 455 SDIPR+STVKIYCP+CEDIYYPRSKYQGSIL Sbjct: 214 SDIPRASTVKIYCPRCEDIYYPRSKYQGSIL 244 >ref|XP_009796642.1| PREDICTED: casein kinase II subunit beta-like isoform X1 [Nicotiana sylvestris] Length = 295 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSILTFYL 443 SDIPRSSTVKIYCPKCEDIYYPRSKYQG+I Y+ Sbjct: 217 SDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYI 251 >gb|KNA11361.1| hypothetical protein SOVF_135920 [Spinacia oleracea] Length = 291 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 547 SDIPRSSTVKIYCPKCEDIYYPRSKYQGSI 458 SDIPRSSTVKIYCPKCEDIYYPRSKYQG+I Sbjct: 219 SDIPRSSTVKIYCPKCEDIYYPRSKYQGNI 248