BLASTX nr result
ID: Papaver31_contig00041901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00041901 (827 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009784696.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X... 61 9e-07 ref|XP_009627640.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 9e-07 ref|XP_013701802.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 1e-06 ref|XP_013693341.1| PREDICTED: 5'-3' exoribonuclease 3-like [Bra... 61 1e-06 ref|XP_013592066.1| PREDICTED: 5'-3' exoribonuclease 3 [Brassica... 61 1e-06 ref|XP_013620922.1| PREDICTED: 5'-3' exoribonuclease 3-like [Bra... 61 1e-06 ref|XP_010909409.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 1e-06 ref|XP_010909408.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 1e-06 ref|XP_010533698.1| PREDICTED: 5'-3' exoribonuclease 3-like [Tar... 61 1e-06 ref|XP_010471679.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 1e-06 ref|XP_010428590.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 1e-06 ref|XP_010416454.1| PREDICTED: 5'-3' exoribonuclease 3 [Camelina... 61 1e-06 ref|XP_009106215.1| PREDICTED: 5'-3' exoribonuclease 3 [Brassica... 61 1e-06 ref|XP_009128117.1| PREDICTED: 5'-3' exoribonuclease 3-like [Bra... 61 1e-06 ref|XP_013686984.1| PREDICTED: 5'-3' exoribonuclease 3-like [Bra... 61 1e-06 emb|CDY39046.1| BnaA02g17350D [Brassica napus] 61 1e-06 ref|XP_013717919.1| PREDICTED: 5'-3' exoribonuclease 3-like [Bra... 61 1e-06 ref|XP_008808991.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X... 61 1e-06 ref|XP_008808990.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X... 61 1e-06 gb|KDO84810.1| hypothetical protein CISIN_1g001209mg [Citrus sin... 61 1e-06 >ref|XP_009784696.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Nicotiana sylvestris] Length = 784 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF+MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFSMVRPRKLL 98 >ref|XP_009627640.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Nicotiana tomentosiformis] Length = 1083 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF+MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFSMVRPRKLL 98 >ref|XP_013701802.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Brassica napus] Length = 1017 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_013693341.1| PREDICTED: 5'-3' exoribonuclease 3-like [Brassica napus] Length = 1034 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_013592066.1| PREDICTED: 5'-3' exoribonuclease 3 [Brassica oleracea var. oleracea] Length = 1017 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_013620922.1| PREDICTED: 5'-3' exoribonuclease 3-like [Brassica oleracea var. oleracea] Length = 1031 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_010909409.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Elaeis guineensis] Length = 1074 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_010909408.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Elaeis guineensis] Length = 1106 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_010533698.1| PREDICTED: 5'-3' exoribonuclease 3-like [Tarenaya hassleriana] Length = 1053 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_010471679.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Camelina sativa] Length = 1049 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_010428590.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Camelina sativa] Length = 1044 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_010416454.1| PREDICTED: 5'-3' exoribonuclease 3 [Camelina sativa] Length = 1032 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_009106215.1| PREDICTED: 5'-3' exoribonuclease 3 [Brassica rapa] Length = 1015 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_009128117.1| PREDICTED: 5'-3' exoribonuclease 3-like [Brassica rapa] Length = 1036 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_013686984.1| PREDICTED: 5'-3' exoribonuclease 3-like [Brassica napus] gi|674919668|emb|CDY13548.1| BnaC02g23590D [Brassica napus] Length = 1030 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >emb|CDY39046.1| BnaA02g17350D [Brassica napus] Length = 1038 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_013717919.1| PREDICTED: 5'-3' exoribonuclease 3-like [Brassica napus] gi|674885017|emb|CDY47507.1| BnaAnng09050D [Brassica napus] Length = 1014 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_008808991.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Phoenix dactylifera] Length = 1072 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +PA TTF+EVFQCMFDYIDRLFA+VRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFAIVRPRKLL 98 >ref|XP_008808990.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Phoenix dactylifera] Length = 1104 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +PA TTF+EVFQCMFDYIDRLFA+VRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFAIVRPRKLL 98 >gb|KDO84810.1| hypothetical protein CISIN_1g001209mg [Citrus sinensis] Length = 789 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 325 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 233 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98