BLASTX nr result
ID: Papaver31_contig00041533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00041533 (639 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB28983.1| hypothetical protein B456_005G078300 [Gossypium r... 94 9e-17 ref|XP_008785845.1| PREDICTED: 60S ribosomal protein L3 [Phoenix... 91 4e-16 emb|CBI18223.3| unnamed protein product [Vitis vinifera] 91 4e-16 ref|XP_010665150.1| PREDICTED: 60S ribosomal protein L3 [Vitis v... 91 4e-16 ref|XP_006389533.1| 60S ribosomal protein L3 [Populus trichocarp... 91 7e-16 ref|XP_006389532.1| hypothetical protein POPTR_0022s00670g [Popu... 91 7e-16 gb|ABK94156.1| unknown [Populus trichocarpa] 91 7e-16 gb|KMZ71700.1| putative 60S ribosomal protein L3 [Zostera marina] 90 1e-15 ref|XP_010087922.1| 60S ribosomal protein L3 [Morus notabilis] g... 90 1e-15 gb|KJB77952.1| hypothetical protein B456_012G169700 [Gossypium r... 90 1e-15 ref|XP_012459018.1| PREDICTED: 60S ribosomal protein L3-2 isofor... 90 1e-15 gb|KJB60016.1| hypothetical protein B456_009G285900 [Gossypium r... 90 1e-15 gb|KJB60015.1| hypothetical protein B456_009G285900 [Gossypium r... 90 1e-15 ref|XP_012446819.1| PREDICTED: 60S ribosomal protein L3 [Gossypi... 90 1e-15 ref|XP_011092302.1| PREDICTED: 60S ribosomal protein L3-2 [Sesam... 90 1e-15 ref|XP_011042876.1| PREDICTED: 60S ribosomal protein L3-1-like i... 90 1e-15 ref|XP_012482411.1| PREDICTED: 60S ribosomal protein L3 [Gossypi... 90 1e-15 gb|KHG10235.1| 60S ribosomal L3-2 -like protein [Gossypium arbor... 90 1e-15 gb|KHG02012.1| 60S ribosomal L3 [Gossypium arboreum] 90 1e-15 ref|XP_008445969.1| PREDICTED: 60S ribosomal protein L3-2 [Cucum... 90 1e-15 >gb|KJB28983.1| hypothetical protein B456_005G078300 [Gossypium raimondii] Length = 379 Score = 93.6 bits (231), Expect = 9e-17 Identities = 46/60 (76%), Positives = 52/60 (86%), Gaps = 2/60 (3%) Frame = -1 Query: 174 IVAVLHSLMMLVL*--IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 +V + S+MML L + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 3 LVWICWSMMMLFLIGAVKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 62 >ref|XP_008785845.1| PREDICTED: 60S ribosomal protein L3 [Phoenix dactylifera] Length = 389 Score = 91.3 bits (225), Expect = 4e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + SFPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKSFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >emb|CBI18223.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 91.3 bits (225), Expect = 4e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 89 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 132 >ref|XP_010665150.1| PREDICTED: 60S ribosomal protein L3 [Vitis vinifera] gi|147833564|emb|CAN63848.1| hypothetical protein VITISV_039858 [Vitis vinifera] Length = 389 Score = 91.3 bits (225), Expect = 4e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_006389533.1| 60S ribosomal protein L3 [Populus trichocarpa] gi|550312356|gb|ERP48447.1| 60S ribosomal protein L3 [Populus trichocarpa] Length = 389 Score = 90.5 bits (223), Expect = 7e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 126 SFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 SFPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 31 SFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_006389532.1| hypothetical protein POPTR_0022s00670g [Populus trichocarpa] gi|550312355|gb|ERP48446.1| hypothetical protein POPTR_0022s00670g [Populus trichocarpa] Length = 358 Score = 90.5 bits (223), Expect = 7e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 126 SFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 SFPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 31 SFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >gb|ABK94156.1| unknown [Populus trichocarpa] Length = 389 Score = 90.5 bits (223), Expect = 7e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 126 SFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 SFPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 31 SFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >gb|KMZ71700.1| putative 60S ribosomal protein L3 [Zostera marina] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_010087922.1| 60S ribosomal protein L3 [Morus notabilis] gi|587840118|gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >gb|KJB77952.1| hypothetical protein B456_012G169700 [Gossypium raimondii] Length = 304 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_012459018.1| PREDICTED: 60S ribosomal protein L3-2 isoform X1 [Gossypium raimondii] gi|763811048|gb|KJB77950.1| hypothetical protein B456_012G169700 [Gossypium raimondii] gi|763811051|gb|KJB77953.1| hypothetical protein B456_012G169700 [Gossypium raimondii] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >gb|KJB60016.1| hypothetical protein B456_009G285900 [Gossypium raimondii] Length = 376 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 16 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 59 >gb|KJB60015.1| hypothetical protein B456_009G285900 [Gossypium raimondii] Length = 309 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_012446819.1| PREDICTED: 60S ribosomal protein L3 [Gossypium raimondii] gi|763793018|gb|KJB60014.1| hypothetical protein B456_009G285900 [Gossypium raimondii] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_011092302.1| PREDICTED: 60S ribosomal protein L3-2 [Sesamum indicum] gi|747089342|ref|XP_011092303.1| PREDICTED: 60S ribosomal protein L3-2 [Sesamum indicum] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_011042876.1| PREDICTED: 60S ribosomal protein L3-1-like isoform X1 [Populus euphratica] gi|743899171|ref|XP_011042877.1| PREDICTED: 60S ribosomal protein L3-1-like isoform X2 [Populus euphratica] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + SFPKDDP+KPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKSFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_012482411.1| PREDICTED: 60S ribosomal protein L3 [Gossypium raimondii] gi|728834469|gb|KHG13912.1| 60S ribosomal L3 [Gossypium arboreum] gi|763761725|gb|KJB28979.1| hypothetical protein B456_005G078300 [Gossypium raimondii] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >gb|KHG10235.1| 60S ribosomal L3-2 -like protein [Gossypium arboreum] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDP+KPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >gb|KHG02012.1| 60S ribosomal L3 [Gossypium arboreum] Length = 389 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FPKDDPSKPC+LTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72 >ref|XP_008445969.1| PREDICTED: 60S ribosomal protein L3-2 [Cucumis melo] Length = 388 Score = 90.1 bits (222), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 132 IPSFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 1 + +FP+DDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET Sbjct: 29 VKAFPRDDPSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKET 72