BLASTX nr result
ID: Papaver31_contig00040314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00040314 (573 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010252467.1| PREDICTED: splicing factor, suppressor of wh... 58 4e-06 >ref|XP_010252467.1| PREDICTED: splicing factor, suppressor of white-apricot homolog [Nelumbo nucifera] Length = 943 Score = 57.8 bits (138), Expect = 4e-06 Identities = 30/56 (53%), Positives = 33/56 (58%) Frame = -1 Query: 420 ELNSGEGQGAGGTYSAVGFSYGNSDVSAGQRNSDSVVGDYGFRPPFPVPENLFQSL 253 E +SG G Y V FSY NSD + QRNSD +G F PPFPVPE L QSL Sbjct: 91 EPDSGAKLADKGAYHTVAFSYENSDATIHQRNSDGGLGSSSFLPPFPVPEFLLQSL 146