BLASTX nr result
ID: Papaver31_contig00039990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00039990 (1073 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_973570.1| actin-related protein C1A [Arabidopsis thaliana... 60 4e-06 >ref|NP_973570.1| actin-related protein C1A [Arabidopsis thaliana] gi|330253362|gb|AEC08456.1| actin-related protein C1A [Arabidopsis thaliana] Length = 378 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 95 FLLNQQIVQLDLCSSWAFGVKWSPSGNTLAY 3 FLL QQI+QLDL SWAFGVKWSPSGNTLAY Sbjct: 192 FLLKQQILQLDLSYSWAFGVKWSPSGNTLAY 222