BLASTX nr result
ID: Papaver31_contig00039743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00039743 (424 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium r... 60 6e-07 >gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium raimondii] Length = 86 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 4 RLVSQEHSQLPTKSFRLSPGLRANAALFLPWMSET 108 RLVSQ+HSQ P +SFRLSPGLRA+A L LPWMSET Sbjct: 6 RLVSQKHSQWPPESFRLSPGLRASAVLLLPWMSET 40