BLASTX nr result
ID: Papaver31_contig00039570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00039570 (533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010036572.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 63 3e-12 >ref|XP_010036572.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X1 [Eucalyptus grandis] gi|629081721|gb|KCW48166.1| hypothetical protein EUGRSUZ_K01902 [Eucalyptus grandis] Length = 640 Score = 62.8 bits (151), Expect(2) = 3e-12 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 5/122 (4%) Frame = -3 Query: 354 LRTIRVHNSMPFDRFKEMVAGQFRVPMQLQLYWMWLKSENQTCRLIRP*YMKKKNLVN*R 175 +R+ R+ MPF FKE VA +F VP+Q Q +W W K +N T R RP + + Sbjct: 52 VRSFRIQKQMPFSLFKEEVAREFGVPVQCQRFWFWAKRQNCTYRPYRP--LTPQEEAQSV 109 Query: 174 GTMQQLPN*YCFWKV-----*SLGRIYVPCVCNLRQKEIFFFFLAVMTLKNKKIRNVGNL 10 G ++++PN K+ LG + VP + + +E F + + ++R VG L Sbjct: 110 GQLREMPNKASNAKLKLFLEVELGLVQVPVSPHKKSEEDILIFFKLYNPEKGELRYVGRL 169 Query: 9 FV 4 FV Sbjct: 170 FV 171 Score = 35.0 bits (79), Expect(2) = 3e-12 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 Query: 436 KAVQNEDFYQQIGRGDYCDFVDHDKVRT 353 K + ED QIG+ Y D VDHDKVR+ Sbjct: 27 KVAREEDLVDQIGKDIYFDLVDHDKVRS 54