BLASTX nr result
ID: Papaver31_contig00037413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00037413 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010648284.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 58 3e-06 ref|XP_010648282.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 58 3e-06 ref|XP_002273029.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 58 3e-06 emb|CAN69374.1| hypothetical protein VITISV_008200 [Vitis vinifera] 58 3e-06 gb|KDO79894.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 gb|KDO79893.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 gb|KDO79892.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 gb|KDO79891.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 gb|KDO79890.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 gb|KDO79889.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 gb|KDO79888.1| hypothetical protein CISIN_1g014300mg [Citrus sin... 57 4e-06 ref|XP_006476009.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 57 4e-06 ref|XP_006476008.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 57 4e-06 ref|XP_006476007.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 57 4e-06 ref|XP_006450725.1| hypothetical protein CICLE_v10010686mg [Citr... 57 4e-06 >ref|XP_010648284.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial isoform X3 [Vitis vinifera] Length = 415 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 DR+L +G+TKAADIADATLNNVYQAMGFLRR Sbjct: 385 DRLLAEGATKAADIADATLNNVYQAMGFLRR 415 >ref|XP_010648282.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial isoform X1 [Vitis vinifera] Length = 421 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 DR+L +G+TKAADIADATLNNVYQAMGFLRR Sbjct: 391 DRLLAEGATKAADIADATLNNVYQAMGFLRR 421 >ref|XP_002273029.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial isoform X2 [Vitis vinifera] gi|296081565|emb|CBI20570.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 DR+L +G+TKAADIADATLNNVYQAMGFLRR Sbjct: 386 DRLLAEGATKAADIADATLNNVYQAMGFLRR 416 >emb|CAN69374.1| hypothetical protein VITISV_008200 [Vitis vinifera] Length = 137 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 DR+L +G+TKAADIADATLNNVYQAMGFLRR Sbjct: 107 DRLLAEGATKAADIADATLNNVYQAMGFLRR 137 >gb|KDO79894.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 416 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 386 DKVLADGAAKAADIADATLNNVYQAMGFLRR 416 >gb|KDO79893.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 424 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 394 DKVLADGAAKAADIADATLNNVYQAMGFLRR 424 >gb|KDO79892.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 405 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 375 DKVLADGAAKAADIADATLNNVYQAMGFLRR 405 >gb|KDO79891.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 413 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 383 DKVLADGAAKAADIADATLNNVYQAMGFLRR 413 >gb|KDO79890.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 389 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 359 DKVLADGAAKAADIADATLNNVYQAMGFLRR 389 >gb|KDO79889.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 419 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 389 DKVLADGAAKAADIADATLNNVYQAMGFLRR 419 >gb|KDO79888.1| hypothetical protein CISIN_1g014300mg [Citrus sinensis] Length = 427 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 397 DKVLADGAAKAADIADATLNNVYQAMGFLRR 427 >ref|XP_006476009.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X3 [Citrus sinensis] Length = 419 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 389 DKVLADGAAKAADIADATLNNVYQAMGFLRR 419 >ref|XP_006476008.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X2 [Citrus sinensis] Length = 424 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 394 DKVLADGAAKAADIADATLNNVYQAMGFLRR 424 >ref|XP_006476007.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X1 [Citrus sinensis] Length = 427 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 397 DKVLADGAAKAADIADATLNNVYQAMGFLRR 427 >ref|XP_006450725.1| hypothetical protein CICLE_v10010686mg [Citrus clementina] gi|557553951|gb|ESR63965.1| hypothetical protein CICLE_v10010686mg [Citrus clementina] Length = 419 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DRVLLDGSTKAADIADATLNNVYQAMGFLRR 315 D+VL DG+ KAADIADATLNNVYQAMGFLRR Sbjct: 389 DKVLADGAAKAADIADATLNNVYQAMGFLRR 419