BLASTX nr result
ID: Papaver31_contig00037241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00037241 (1025 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT27300.1| hypothetical protein F775_05495 [Aegilops tauschii] 60 3e-06 >gb|EMT27300.1| hypothetical protein F775_05495 [Aegilops tauschii] Length = 560 Score = 60.1 bits (144), Expect = 3e-06 Identities = 31/96 (32%), Positives = 52/96 (54%) Frame = -2 Query: 658 ATKVFFNLAIPEVLDMRERSCRITPSRQITHPDRNKQPVVDLTMPDNTKTISELLECKWD 479 ATKV+ +L IPE +++ R C + T P+ + Q + M N KT+ E+ E ++ Sbjct: 254 ATKVYIDLDIPETAELQTRYCLEDDIIEETRPEAHLQGTIQEQMLYNRKTLREITEIAYE 313 Query: 478 SKQQALNRIIVKASATRVITNKGWYYLGCNKCTAKV 371 S++Q +A+ + T+ WYY+GC KC K+ Sbjct: 314 SEKQE-KFYTAEATIKSIDTSDEWYYIGCGKCNKKL 348