BLASTX nr result
ID: Papaver31_contig00034982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034982 (986 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010687576.1| PREDICTED: E3 ubiquitin-protein ligase liste... 41 5e-06 >ref|XP_010687576.1| PREDICTED: E3 ubiquitin-protein ligase listerin [Beta vulgaris subsp. vulgaris] gi|870851365|gb|KMT03412.1| hypothetical protein BVRB_8g190980 [Beta vulgaris subsp. vulgaris] Length = 1883 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 847 QFHLSCISKWFSISKNSICPLCGCKF 770 +FH SC+ KWFS S SICPLC F Sbjct: 1858 KFHASCLYKWFSTSHKSICPLCQSPF 1883 Score = 38.1 bits (87), Expect(2) = 5e-06 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -3 Query: 954 QGNLVEELKIVEECPICISRIRLSTQSRPSVSCDTC 847 + N+ +E + VEECPIC S I + S P ++C TC Sbjct: 1820 KSNIDKEFEGVEECPICYSVISTTNHSLPRLACKTC 1855