BLASTX nr result
ID: Papaver31_contig00034935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034935 (584 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503448.1| PREDICTED: protein tesmin/TSO1-like CXC 5 [C... 53 7e-06 >ref|XP_004503448.1| PREDICTED: protein tesmin/TSO1-like CXC 5 [Cicer arietinum] Length = 561 Score = 52.8 bits (125), Expect(2) = 7e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +1 Query: 490 GVYCDGCNRTSCSNNVENKTTRKEAVEATLE 582 G+YCDGCN +C NNV+N+ R+EAVEATLE Sbjct: 111 GIYCDGCNCVNCFNNVDNEAARREAVEATLE 141 Score = 23.9 bits (50), Expect(2) = 7e-06 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Frame = +2 Query: 221 ALPSESPGINEIPKQIHPRMKET*KGPPSAE----EKDLKKNAPKIPPTSVV-KQQKQ 379 A P P + +P+Q P + T PSA+ E K P V K+QKQ Sbjct: 35 AFPGGIPVTSPLPEQTQPPLTTTLPSLPSAKFVKPESPKSKTRPNFETKDVTPKKQKQ 92