BLASTX nr result
ID: Papaver31_contig00034483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034483 (626 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF43043.1|AF236059_1 putative Myb-related domain, partial [P... 53 3e-07 >gb|AAF43043.1|AF236059_1 putative Myb-related domain, partial [Papaver rhoeas] Length = 566 Score = 53.1 bits (126), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 567 EDDKILEFV--YGPSKWSVKTKEMPGRVGKKC*ER 469 EDDKI+E V YGPSKWS+ KE+PGR+GK+C ER Sbjct: 148 EDDKIMELVSKYGPSKWSLIAKELPGRIGKQCRER 182 Score = 28.5 bits (62), Expect(2) = 3e-07 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 625 DEKLQKAGESLKEKIWKQI 569 DEKL+KA ES K K WK+I Sbjct: 97 DEKLRKAVESFKGKNWKKI 115