BLASTX nr result
ID: Papaver31_contig00034120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034120 (463 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623558.1| regulator of chromosome condensation (RCC1) ... 60 6e-07 >ref|XP_003623558.1| regulator of chromosome condensation (RCC1) family protein [Medicago truncatula] gi|355498573|gb|AES79776.1| regulator of chromosome condensation (RCC1) family protein [Medicago truncatula] Length = 1108 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/86 (39%), Positives = 44/86 (51%), Gaps = 1/86 (1%) Frame = -1 Query: 463 VRFSKRKFDGQQAAEWWKENSHRVFMKYKNLGGDVTQIGSSS-NGKTAEQEDLARHSVNT 287 V+FSKRKF QA EWW N RV +Y + + SSS A QED+A S N Sbjct: 1022 VKFSKRKFREHQAEEWWTLNKDRVHARYSPQATNPENVASSSRTPPPANQEDVASSSSNP 1081 Query: 286 KAAEEEEPGTPSANAKTAKEEEPGTP 209 A +E+ + S+N A+E TP Sbjct: 1082 PPANQEDVASSSSNPPPAEENNEATP 1107