BLASTX nr result
ID: Papaver31_contig00033950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00033950 (573 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO85289.1| hypothetical protein CISIN_1g001317mg [Citrus sin... 58 4e-06 gb|KDO85288.1| hypothetical protein CISIN_1g001317mg [Citrus sin... 58 4e-06 gb|KDO85285.1| hypothetical protein CISIN_1g001317mg [Citrus sin... 58 4e-06 gb|KDO85284.1| hypothetical protein CISIN_1g001317mg [Citrus sin... 58 4e-06 gb|KDO85283.1| hypothetical protein CISIN_1g001317mg [Citrus sin... 58 4e-06 gb|KDO85282.1| hypothetical protein CISIN_1g001317mg [Citrus sin... 58 4e-06 ref|XP_006494445.1| PREDICTED: squamosa promoter-binding-like pr... 58 4e-06 ref|XP_006494443.1| PREDICTED: squamosa promoter-binding-like pr... 58 4e-06 ref|XP_006435483.1| hypothetical protein CICLE_v10000100mg [Citr... 58 4e-06 >gb|KDO85289.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 847 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 375 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 412 >gb|KDO85288.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 1075 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 603 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 640 >gb|KDO85285.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 711 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 630 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 667 >gb|KDO85284.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 776 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 630 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 667 >gb|KDO85283.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 778 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 630 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 667 >gb|KDO85282.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 978 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 630 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 667 >ref|XP_006494445.1| PREDICTED: squamosa promoter-binding-like protein 14-like isoform X3 [Citrus sinensis] Length = 1075 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 603 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 640 >ref|XP_006494443.1| PREDICTED: squamosa promoter-binding-like protein 14-like isoform X1 [Citrus sinensis] gi|568883372|ref|XP_006494444.1| PREDICTED: squamosa promoter-binding-like protein 14-like isoform X2 [Citrus sinensis] Length = 1102 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 630 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 667 >ref|XP_006435483.1| hypothetical protein CICLE_v10000100mg [Citrus clementina] gi|557537605|gb|ESR48723.1| hypothetical protein CICLE_v10000100mg [Citrus clementina] gi|641866595|gb|KDO85280.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] gi|641866596|gb|KDO85281.1| hypothetical protein CISIN_1g001317mg [Citrus sinensis] Length = 1102 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 156 DLLQCVNFLVRDMDPGFWNNERFLVHTGRQLASHKDEN 43 +LLQ +N LV+D D FW N RFLVHTG+QLASHKD N Sbjct: 630 NLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGN 667