BLASTX nr result
ID: Papaver31_contig00033527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00033527 (574 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523327.1| importin-alpha re-exporter, putative [Ricinu... 63 1e-07 ref|XP_012083195.1| PREDICTED: exportin-2 [Jatropha curcas] gi|6... 60 8e-07 ref|XP_010053833.1| PREDICTED: exportin-2 [Eucalyptus grandis] g... 60 1e-06 ref|XP_007051524.1| Cellular apoptosis susceptibility protein / ... 59 2e-06 >ref|XP_002523327.1| importin-alpha re-exporter, putative [Ricinus communis] gi|223537415|gb|EEF39043.1| importin-alpha re-exporter, putative [Ricinus communis] Length = 969 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 574 SPGRYPTIIQQSLDPANQTALLQLCSTYNCTIV 476 SPGRYP II ++LDPANQTALLQLCSTYNC IV Sbjct: 937 SPGRYPQIISENLDPANQTALLQLCSTYNCPIV 969 >ref|XP_012083195.1| PREDICTED: exportin-2 [Jatropha curcas] gi|643716848|gb|KDP28474.1| hypothetical protein JCGZ_14245 [Jatropha curcas] Length = 969 Score = 60.1 bits (144), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 574 SPGRYPTIIQQSLDPANQTALLQLCSTYNCTIV 476 SPGRYP II ++L+PANQTAL+QLCSTYNC IV Sbjct: 937 SPGRYPHIISENLEPANQTALMQLCSTYNCPIV 969 >ref|XP_010053833.1| PREDICTED: exportin-2 [Eucalyptus grandis] gi|629113233|gb|KCW78193.1| hypothetical protein EUGRSUZ_D02383 [Eucalyptus grandis] Length = 983 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 574 SPGRYPTIIQQSLDPANQTALLQLCSTYNCTIV 476 SPG+YP II ++LDPANQ ALLQLCSTYNC IV Sbjct: 951 SPGKYPQIISENLDPANQNALLQLCSTYNCPIV 983 >ref|XP_007051524.1| Cellular apoptosis susceptibility protein / importin-alpha re-exporter, putative isoform 1 [Theobroma cacao] gi|590721142|ref|XP_007051525.1| Cellular apoptosis susceptibility protein / importin-alpha re-exporter, putative isoform 1 [Theobroma cacao] gi|508703785|gb|EOX95681.1| Cellular apoptosis susceptibility protein / importin-alpha re-exporter, putative isoform 1 [Theobroma cacao] gi|508703786|gb|EOX95682.1| Cellular apoptosis susceptibility protein / importin-alpha re-exporter, putative isoform 1 [Theobroma cacao] Length = 977 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 574 SPGRYPTIIQQSLDPANQTALLQLCSTYNCTIV 476 +PGR+P II ++L+PANQ ALLQLCSTYNCTIV Sbjct: 945 TPGRFPQIINENLEPANQAALLQLCSTYNCTIV 977