BLASTX nr result
ID: Papaver31_contig00032906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00032906 (649 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit ... 136 9e-30 emb|CDP16669.1| unnamed protein product [Coffea canephora] 129 1e-27 ref|XP_006338677.1| PREDICTED: COP9 signalosome complex subunit ... 129 2e-27 ref|XP_004231795.1| PREDICTED: COP9 signalosome complex subunit ... 129 2e-27 gb|KCW55855.1| hypothetical protein EUGRSUZ_I01664 [Eucalyptus g... 128 2e-27 ref|XP_010029025.1| PREDICTED: COP9 signalosome complex subunit ... 128 2e-27 ref|XP_010029024.1| PREDICTED: COP9 signalosome complex subunit ... 128 2e-27 ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putati... 128 2e-27 gb|EPS70923.1| hypothetical protein M569_03832, partial [Genlise... 128 2e-27 ref|XP_012070898.1| PREDICTED: COP9 signalosome complex subunit ... 128 3e-27 ref|XP_006447130.1| hypothetical protein CICLE_v10015345mg [Citr... 127 6e-27 ref|XP_010250794.1| PREDICTED: COP9 signalosome complex subunit ... 127 7e-27 ref|XP_007151544.1| hypothetical protein PHAVU_004G055700g [Phas... 127 7e-27 ref|XP_009804307.1| PREDICTED: COP9 signalosome complex subunit ... 126 9e-27 ref|XP_009627504.1| PREDICTED: COP9 signalosome complex subunit ... 126 9e-27 ref|XP_009587706.1| PREDICTED: COP9 signalosome complex subunit ... 126 1e-26 ref|XP_009587705.1| PREDICTED: COP9 signalosome complex subunit ... 126 1e-26 ref|XP_012840728.1| PREDICTED: COP9 signalosome complex subunit ... 125 2e-26 ref|XP_008441368.1| PREDICTED: COP9 signalosome complex subunit ... 125 2e-26 ref|XP_014502234.1| PREDICTED: COP9 signalosome complex subunit ... 125 3e-26 >ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit 3 [Vitis vinifera] gi|296090247|emb|CBI40066.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 136 bits (343), Expect = 9e-30 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM ++N IAVEAYKKYILV+LI NGQFS TFPKY Sbjct: 182 YGGMICIGQKRFRKALELLHNVVTAPMSTINAIAVEAYKKYILVSLIHNGQFSTTFPKYT 241 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK+FSQPYLDLA Sbjct: 242 SSVAQRNLKNFSQPYLDLA 260 >emb|CDP16669.1| unnamed protein product [Coffea canephora] Length = 434 Score = 129 bits (325), Expect = 1e-27 Identities = 62/79 (78%), Positives = 71/79 (89%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A +LLHNVVTAPM ++N IAVEAYKKYILV+LI GQFS +FPKY Sbjct: 192 YGGMICIGQKQFRKASELLHNVVTAPMSTINAIAVEAYKKYILVSLIYAGQFSTSFPKYT 251 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK+FSQPYLDLA Sbjct: 252 SSVAQRNLKNFSQPYLDLA 270 >ref|XP_006338677.1| PREDICTED: COP9 signalosome complex subunit 3-like [Solanum tuberosum] Length = 428 Score = 129 bits (323), Expect = 2e-27 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGM+CIGQK+FR+A++LLHNVVTAPM +LN IAVEAYKKYILV+LI GQFS +FPKY Sbjct: 186 YGGMVCIGQKQFRKALELLHNVVTAPMSTLNAIAVEAYKKYILVSLIHLGQFSTSFPKYT 245 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK+FSQPYL+L+ Sbjct: 246 SSVAQRNLKNFSQPYLELS 264 >ref|XP_004231795.1| PREDICTED: COP9 signalosome complex subunit 3 [Solanum lycopersicum] Length = 428 Score = 129 bits (323), Expect = 2e-27 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGM+CIGQK+FR+A++LLHNVVTAPM +LN IAVEAYKKYILV+LI GQFS +FPKY Sbjct: 186 YGGMVCIGQKQFRKALELLHNVVTAPMSTLNAIAVEAYKKYILVSLIHLGQFSTSFPKYT 245 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK+FSQPYL+L+ Sbjct: 246 SSVAQRNLKNFSQPYLELS 264 >gb|KCW55855.1| hypothetical protein EUGRSUZ_I01664 [Eucalyptus grandis] Length = 433 Score = 128 bits (322), Expect = 2e-27 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM ++N IAVEAYKKYILV+LI GQFS + PKYA Sbjct: 182 YGGMICIGQKRFRKALELLHNVVTAPMNAINAIAVEAYKKYILVSLIHYGQFSTSLPKYA 241 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR+LK+F QPY++LA Sbjct: 242 SSAAQRNLKNFCQPYIELA 260 >ref|XP_010029025.1| PREDICTED: COP9 signalosome complex subunit 3 isoform X2 [Eucalyptus grandis] gi|629089600|gb|KCW55853.1| hypothetical protein EUGRSUZ_I01664 [Eucalyptus grandis] Length = 424 Score = 128 bits (322), Expect = 2e-27 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM ++N IAVEAYKKYILV+LI GQFS + PKYA Sbjct: 182 YGGMICIGQKRFRKALELLHNVVTAPMNAINAIAVEAYKKYILVSLIHYGQFSTSLPKYA 241 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR+LK+F QPY++LA Sbjct: 242 SSAAQRNLKNFCQPYIELA 260 >ref|XP_010029024.1| PREDICTED: COP9 signalosome complex subunit 3 isoform X1 [Eucalyptus grandis] gi|629089599|gb|KCW55852.1| hypothetical protein EUGRSUZ_I01664 [Eucalyptus grandis] Length = 429 Score = 128 bits (322), Expect = 2e-27 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM ++N IAVEAYKKYILV+LI GQFS + PKYA Sbjct: 182 YGGMICIGQKRFRKALELLHNVVTAPMNAINAIAVEAYKKYILVSLIHYGQFSTSLPKYA 241 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR+LK+F QPY++LA Sbjct: 242 SSAAQRNLKNFCQPYIELA 260 >ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] gi|223549455|gb|EEF50943.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] Length = 427 Score = 128 bits (322), Expect = 2e-27 Identities = 59/79 (74%), Positives = 71/79 (89%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGM+CIGQK+FR+A++LLHNVVTAPM S+N IAVEAYKKYIL +LI GQFS + PKYA Sbjct: 185 YGGMVCIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILASLIHQGQFSTSLPKYA 244 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR+LK+F QPY++LA Sbjct: 245 SSAAQRNLKNFCQPYIELA 263 >gb|EPS70923.1| hypothetical protein M569_03832, partial [Genlisea aurea] Length = 419 Score = 128 bits (322), Expect = 2e-27 Identities = 61/79 (77%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM ++ IAVEAYKKYILV+LI GQFSA FPKY Sbjct: 185 YGGMICIGQKQFRKALELLHNVVTAPMPIISAIAVEAYKKYILVSLIHLGQFSAVFPKYT 244 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR++K+FSQPY+DLA Sbjct: 245 SSAAQRNVKNFSQPYIDLA 263 >ref|XP_012070898.1| PREDICTED: COP9 signalosome complex subunit 3 [Jatropha curcas] gi|643740731|gb|KDP46321.1| hypothetical protein JCGZ_10161 [Jatropha curcas] Length = 424 Score = 128 bits (321), Expect = 3e-27 Identities = 59/79 (74%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+F++A++LLHNVVTAPM S+N IAVEAYKKYILV+LI GQFS + PKYA Sbjct: 182 YGGMICIGQKRFKKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHQGQFSTSLPKYA 241 Query: 59 SSAAQRSLKHFSQPYLDLA 3 S+AAQR+LK+F QPY++LA Sbjct: 242 STAAQRNLKNFCQPYIELA 260 >ref|XP_006447130.1| hypothetical protein CICLE_v10015345mg [Citrus clementina] gi|568831517|ref|XP_006470009.1| PREDICTED: COP9 signalosome complex subunit 3-like [Citrus sinensis] gi|557549741|gb|ESR60370.1| hypothetical protein CICLE_v10015345mg [Citrus clementina] Length = 424 Score = 127 bits (319), Expect = 6e-27 Identities = 60/78 (76%), Positives = 72/78 (92%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMI IGQK+FR+A++LLHNVVTAPM S+N IAVEAYKKYILV+LI +GQFS+T PKY Sbjct: 182 YGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYT 241 Query: 59 SSAAQRSLKHFSQPYLDL 6 SSAAQR+LK+FSQPY++L Sbjct: 242 SSAAQRNLKNFSQPYMEL 259 >ref|XP_010250794.1| PREDICTED: COP9 signalosome complex subunit 3 [Nelumbo nucifera] Length = 424 Score = 127 bits (318), Expect = 7e-27 Identities = 60/79 (75%), Positives = 69/79 (87%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM + N IA+EAYKKY LV+LI NGQFS T PKY Sbjct: 182 YGGMICIGQKQFRKAMELLHNVVTAPMPTTNAIAIEAYKKYCLVSLILNGQFSTTLPKYT 241 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQRSLK+F QPY+DLA Sbjct: 242 SSVAQRSLKNFCQPYVDLA 260 >ref|XP_007151544.1| hypothetical protein PHAVU_004G055700g [Phaseolus vulgaris] gi|561024853|gb|ESW23538.1| hypothetical protein PHAVU_004G055700g [Phaseolus vulgaris] Length = 422 Score = 127 bits (318), Expect = 7e-27 Identities = 59/79 (74%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+F++A+ LLHNVVTAPM +N IAVEAYKKYILV+LI+NGQFS + PKY+ Sbjct: 181 YGGMICIGQKRFQKALDLLHNVVTAPMSIINAIAVEAYKKYILVSLIRNGQFSTSLPKYS 240 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR+LK+F QPY++LA Sbjct: 241 SSAAQRNLKNFCQPYVELA 259 >ref|XP_009804307.1| PREDICTED: COP9 signalosome complex subunit 3-like [Nicotiana sylvestris] Length = 428 Score = 126 bits (317), Expect = 9e-27 Identities = 59/79 (74%), Positives = 71/79 (89%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGM+CIGQK+FR+A++LLHNVVTAPM +LN IAVEAYKKYILV+LI GQFS +FPKY Sbjct: 186 YGGMVCIGQKQFRKALELLHNVVTAPMSTLNAIAVEAYKKYILVSLIHLGQFSTSFPKYT 245 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK ++QPYL+LA Sbjct: 246 SSVAQRNLKTYAQPYLELA 264 >ref|XP_009627504.1| PREDICTED: COP9 signalosome complex subunit 3-like [Nicotiana tomentosiformis] Length = 428 Score = 126 bits (317), Expect = 9e-27 Identities = 61/79 (77%), Positives = 72/79 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+F +A++LLHNVVTAPM +LN IAVEAYKKYILV+LI+ GQFSA+FPK+ Sbjct: 186 YGGMICIGQKQFGKALELLHNVVTAPMSTLNAIAVEAYKKYILVSLIRLGQFSASFPKHT 245 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK FSQPYL+LA Sbjct: 246 SSVAQRNLKTFSQPYLELA 264 >ref|XP_009587706.1| PREDICTED: COP9 signalosome complex subunit 3-like isoform X2 [Nicotiana tomentosiformis] Length = 400 Score = 126 bits (316), Expect = 1e-26 Identities = 59/79 (74%), Positives = 71/79 (89%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGM+CIGQK+FR+A++LLHNVVTAPM +LN IAVEAYKKYILV+LI GQFS +FPKY Sbjct: 186 YGGMVCIGQKQFRKALELLHNVVTAPMSTLNAIAVEAYKKYILVSLIHVGQFSISFPKYT 245 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK ++QPYL+LA Sbjct: 246 SSVAQRNLKTYAQPYLELA 264 >ref|XP_009587705.1| PREDICTED: COP9 signalosome complex subunit 3-like isoform X1 [Nicotiana tomentosiformis] Length = 428 Score = 126 bits (316), Expect = 1e-26 Identities = 59/79 (74%), Positives = 71/79 (89%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGM+CIGQK+FR+A++LLHNVVTAPM +LN IAVEAYKKYILV+LI GQFS +FPKY Sbjct: 186 YGGMVCIGQKQFRKALELLHNVVTAPMSTLNAIAVEAYKKYILVSLIHVGQFSISFPKYT 245 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK ++QPYL+LA Sbjct: 246 SSVAQRNLKTYAQPYLELA 264 >ref|XP_012840728.1| PREDICTED: COP9 signalosome complex subunit 3 [Erythranthe guttatus] gi|604329458|gb|EYU34789.1| hypothetical protein MIMGU_mgv1a006897mg [Erythranthe guttata] Length = 427 Score = 125 bits (315), Expect = 2e-26 Identities = 60/78 (76%), Positives = 71/78 (91%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIGQK+FR+A++LLHNVVTAPM ++ IAVEAYKKYILV+LI +GQFS +FPKYA Sbjct: 186 YGGMICIGQKQFRKALELLHNVVTAPMAIVSAIAVEAYKKYILVSLIHHGQFSTSFPKYA 245 Query: 59 SSAAQRSLKHFSQPYLDL 6 S AAQR+LK+FSQ YLDL Sbjct: 246 SQAAQRNLKNFSQAYLDL 263 >ref|XP_008441368.1| PREDICTED: COP9 signalosome complex subunit 3 [Cucumis melo] Length = 423 Score = 125 bits (314), Expect = 2e-26 Identities = 59/79 (74%), Positives = 70/79 (88%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIG K F++A++LLHNVVTAPMQS+N IAVEAYKKYILV+LI NGQFS + PKY Sbjct: 181 YGGMICIGLKLFQKALELLHNVVTAPMQSMNAIAVEAYKKYILVSLIYNGQFSTSLPKYT 240 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SS AQR+LK+F QPY++LA Sbjct: 241 SSVAQRNLKNFCQPYIELA 259 >ref|XP_014502234.1| PREDICTED: COP9 signalosome complex subunit 3 [Vigna radiata var. radiata] Length = 422 Score = 125 bits (313), Expect = 3e-26 Identities = 58/79 (73%), Positives = 71/79 (89%) Frame = -3 Query: 239 YGGMICIGQKKFRRAIQLLHNVVTAPMQSLNCIAVEAYKKYILVNLIQNGQFSATFPKYA 60 YGGMICIG K+F++A+ LLHNVVTAPM +N IAVEAYKKYILV+LI+NGQFS + PKY+ Sbjct: 181 YGGMICIGMKRFQKALDLLHNVVTAPMSVINAIAVEAYKKYILVSLIRNGQFSTSLPKYS 240 Query: 59 SSAAQRSLKHFSQPYLDLA 3 SSAAQR+LK+F QPY++LA Sbjct: 241 SSAAQRNLKNFCQPYVELA 259